KEGG   Komagataella pastoris: PAS_chr2-2_0107Help
Entry
PAS_chr2-2_0107   CDS       T01092                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ppa  Komagataella pastoris
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PAS_chr2-2_0107
  Lipid metabolism
   00062 Fatty acid elongation
    PAS_chr2-2_0107
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     PAS_chr2-2_0107
Lipid biosynthesis proteins [BR:ppa01004]
 Fatty acid synthase
  Component type
   PAS_chr2-2_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2179729..2180637)
Genome map
AA seq 302 aa AA seqDB search
MWFDKPISLIQSFSILQWIIPFGHLNECKLRSDPKVVLWHGLGDFYNSPSISKVEEQITS
LYPNAFIHSIRISEDSASDQRSSFVGNLNDQLKLVHEQLLEIPELDQGFVAIGFSQGGLF
LRSLVETASDLNVTTLITFGSPHNGIYDLPTCEENDWLCKRKNQVLKSRIWSPSVQESVV
PAQYFRDPSHWDDYIAHSGFIRDINNELKVNYTYIENMKKLERLVLVKFDQDDTLVPKES
AWFLDFSKEGELIGFTDTASYSQNLIGLKDLYENSRIDFLEINDRHMAISDEFFRDILEK
YL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttgataaacccattagtctcattcaaagcttttcaattctgcaatggatcatt
ccatttggacacctaaatgagtgtaagctgagaagtgacccaaaggttgttctgtggcat
ggattgggggatttttacaattccccatctatttcaaaagtagaagaacagatcactagt
ctgtaccccaatgcctttatccattccatccgtatctctgaagacagtgcaagtgaccag
agatcttcttttgttggtaacctgaacgatcagttgaaattggtccatgaacagttgctg
gaaataccggaattggaccaaggattcgttgcaattgggttctcccagggaggattgttt
ctgcgaagtttagtggagacggcatcggatttgaatgttactactttgattacatttggt
tcccctcacaatggaatttacgatttgcccacctgtgaggaaaatgattggctatgtaaa
cgaaagaatcaggttttgaagagtagaatttggtctccttcagtgcaagaaagtgttgtg
ccggcacaatactttagagatcctagtcattgggatgactacattgctcattcgggattc
attagggatatcaataacgaactaaaggtgaactatacatatattgagaacatgaaaaag
cttgaacgcttagtattggtcaaatttgatcaggacgatactttagtgccaaaagaaagt
gcatggtttctagatttcagtaaggaaggtgaattgatcggctttactgacacagcttcc
tactctcaaaacttgatcggattaaaagatctctacgaaaacagtagaattgactttctt
gaaatcaatgataggcacatggcaatctctgatgagttcttccgggatattctggaaaaa
tatttatag

DBGET integrated database retrieval system