KEGG   Pichia pastoris: PAS_chr2-2_0127Help
Entry
PAS_chr2-2_0127   CDS       T01092                                 

Definition
Mitochondrial cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PAS_chr2-2_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2148090..2149220
Genome map
AA seq 376 aa AA seqDB search
MSSIAFHTFRGSRAKMATALLLTGAVGAGSYHYEKKRRQFNNRNNNNNNNKNNKNFAKAL
FGFSTGTAAATLTDESKVKVATLSDIHSFKEYQQVYNDIAKKIEDEDDFDVDGSAGPNLV
RLAWHSAGTYDKYDKNPHTNGGSYGGTMRFSKEGGDGANNGLAKGREFLEPLLKKYTWLS
HGDLWTLAGVVAIQEMGGPKIKWRPGRKDLSEEYQAPNGKLPDAAQGPDYVRKFFNRLDF
TDREMVALIGAHTLGRCHVTSSGYDGPWDFAPTMFDNGFFTQLQKGVGSGEGQWHLRKWD
GPEQYEDNNSNSLMMLPADMALVQDPKFKKIVDEFAASQEAFFNEFAPAFQKLLESGIHF
PKESKELVFRTLDEQS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccattgcattccatacattcagaggttccagagctaagatggctacggccctc
cttctgacaggagccgtgggagctggaagctaccactacgagaaaaagagacgtcaattt
aacaataggaacaataacaacaataacaataagaacaacaagaattttgccaaagctcta
ttcggattttctacaggaactgctgctgccactttaaccgatgagagtaaagtgaaagta
gctactttatcagatatccattctttcaaagaataccaacaggtctataatgatatcgcc
aagaagatagaggacgaggacgactttgacgtagacggatctgctggacctaacttggtg
agattggcatggcattctgctggaacttacgacaagtacgacaagaaccctcataccaac
ggtggttcttacggaggaacaatgagattttctaaggaagggggtgacggtgccaataac
ggattagccaaaggaagagagtttctagagccccttttaaagaagtacacatggctttca
cacggtgacttgtggaccttggctggtgttgttgctattcaagagatgggtggtccaaag
ataaaatggagaccaggaagaaaagatttgtctgaagagtaccaagcaccaaacggaaag
ctaccagatgcagctcaaggacctgattatgttcgtaaatttttcaaccgtctagatttt
accgatagagaaatggttgctctgattggtgcccacaccctgggaagatgtcatgttacg
agcagtggttacgatggaccatgggattttgctcctaccatgtttgacaacggatttttc
actcaattacaaaaaggagtaggttcaggtgaagggcaatggcatttgagaaaatgggat
ggccctgaacagtacgaagacaacaattccaattctttgatgatgctgcctgctgacatg
gctcttgttcaggatccaaagttcaagaagattgttgatgagtttgctgcttcacaggag
gcatttttcaatgagtttgcccctgccttccagaagctgttggagagtggtattcatttc
cccaaggaatccaaagagttggtgttcaggacactagacgagcagagttag

DBGET integrated database retrieval system