KEGG   Pichia pastoris: PAS_chr2-2_0193Help
Entry
PAS_chr2-2_0193   CDS       T01092                                 

Definition
Ceramide synthase component
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ppa  Pichia pastoris
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PAS_chr2-2_0193
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     PAS_chr2-2_0193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2022201..2023337
Genome map
AA seq 378 aa AA seqDB search
MGVETSSSGTQHFSDDGCVSSRKPNATVSFEKPERANELKNHKIYKKSKASWLQRNQILL
ASSLLNALFILKQIPSFQSLVNKFFHLQYKNLDGTYDIGKDDYFFVIYWIINLTIIRSVL
MDWVLEPLAIKIVGINNRKALTRFKEQGWSLFYYTTSWTVGFYLYYKSDYFFNCDHIFIG
WPNNKLDFYFKSYYLIQMSCWLQQIVVLNIEERRKDYVQMFSHHIITCLLIIGSYYYYFL
QIGHVILVMMDIVDVFLSLAKMLKYCGYSTLCDVMFFIFLVSWIAIRHVCYNYVFWHTCT
KSRDLMNADCSRYAIYGGPLDVTPVRCYTDSTIRYFIFLLGGLQIITLIWMYLILKVFIG
VITGKGAEDVRSDDEESS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttgaaacatcttcctctggaactcaacatttcagtgatgacggttgtgtatct
tcaaggaagccaaatgctactgtaagctttgagaagcctgagcgtgctaacgagctgaag
aatcacaaaatctataaaaagtccaaggcttcatggttacagagaaatcaaattttacta
gcatcttcattgttgaacgcgttgttcatcttaaagcaaattccctcatttcaatcactc
gttaataaattctttcatttacagtacaagaacttagatggtacttatgatattggtaaa
gacgactattttttcgttatttactggataatcaacttgactattattcgcagtgtcttg
atggattgggtcctagaacccttggcaattaagatagttgggattaacaatagaaaagct
cttaccagatttaaagaacagggttggtctttattctactacaccacgtcatggactgtg
ggcttctatttatactacaagtccgactattttttcaattgtgatcatattttcatcggc
tggcccaacaataagctggatttctacttcaaatcttactacttgattcaaatgtcatgt
tggctccagcagatcgttgttttgaacatagaggagagaagaaaagattatgttcaaatg
ttctcgcatcatataataacctgtttgctgattattggctcttactactattacttttta
cagattggacacgtcattttggttatgatggacattgttgacgtttttctcagtcttgcc
aaaatgttaaaatactgtggttacagcactctctgcgacgtgatgtttttcatattcttg
gtttcatggatagctataagacacgtgtgttacaactacgtgttctggcacacatgcacc
aagtctagggatctaatgaacgcagattgttccaggtacgcaatctacggaggtcccttg
gacgttactccagtacgatgctatacagatagtaccattagatacttcattttccttctt
ggaggtctccaaattatcacactaatctggatgtacctcattctaaaagttttcataggg
gtaataacgggcaaaggtgctgaagacgttagaagtgatgatgaggagagttcttga

DBGET integrated database retrieval system