KEGG   Pichia pastoris: PAS_chr2-2_0203Help
Entry
PAS_chr2-2_0203   CDS       T01092                                 

Definition
Ubiquitin-specific protease that removes ubiquitin from ubiquitinated proteins
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PAS_chr2-2_0203
Peptidases [BR:ppa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAS_chr2-2_0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2005508..2007292
Genome map
AA seq 594 aa AA seqDB search
MDRFNPLRNRRLYNNNPEQQRSLSLALANGGCIGGLFNDGNTCFMNSVIQCLASSNELCD
FLDLITKSEDRSFSKELKRLIDNLNSRHGKKVVTYKTNRLLKSLTNGPNKRLFLGYDQED
AQEFYQLIMQQLEKDIKPDQEKKQKEVNPRDLFVPRTNDMVYGLETLGALGKCYVPALQV
DPSAVDAEEKVYPLELLTPVDGLSCERIGCLTCGEMGGIRYSTISGIGLNLPSSKQPSIS
LTSLLDTWIAPEVIEDVECVRCGLRQIKQFVQGSLDAASNEKLRAVFQSRIDEIDSELSK
PVINEEVYKKLHTKNMIKKSKKVKQIFFSRPPPLLCVHINRSVFDPNTYMIRKNNAKVVF
SERLDLSNYVAVPDDVNMDARLSFRKQDQGKEKSWTQEFSEEEHGIQDQDEDDVTDVGPL
TYSLKSIICHYGTHNYGHYIAFRKYRGVWWRISDETVTVSDLQEVLNTSGTFMMFYELSQ
RNDDRDTIKSIDFNNVEITDPSEEVKGQETDHRTRSNQLTTSDVDIDGLPSDLEADEAEE
HSDSESPSESESDQESEYQQQLDSGESIIGNYNNDTENTSSEEKVDQALLQANL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggatagatttaatcctcttagaaatagaaggctgtacaacaacaatcccgagcagcag
cgtagcctttctttagcacttgcaaatggtggctgtattggaggactattcaatgatggt
aacacatgctttatgaactcggtcatacaatgtttagcatcttccaacgaattatgtgat
tttttggacctaatcacaaagtcggaagatagatctttctcaaaagagctcaaacgccta
atagacaatctcaacagtagacacgggaagaaagtcgtcacatacaagacgaatcgactg
ctcaaatcccttactaacggaccaaataagcgtctgttcttaggctacgaccaggaagac
gctcaggagttttaccagctgataatgcaacaattggaaaaggatatcaaacccgaccag
gaaaaaaagcagaaagaagtgaatcctagggacctttttgttcctagaacgaacgatatg
gtgtacggtttagaaacccttggagcccttggaaaatgttacgttcctgcgttgcaagtg
gatccctcagctgttgatgccgaggagaaagtatatccgctagagctactaaccccagta
gatggactttcatgtgaaagaattggatgtctaacgtgtggtgaaatgggaggaatccgc
tattctacgatatctggtatcggtttgaatctaccgagtagtaaacaaccatcaatctct
ctaacatctttgctggacacttggattgctccagaagtcattgaagatgtggagtgtgtt
cggtgtggccttcgccaaattaaacaatttgttcagggttctcttgatgctgcaagcaat
gaaaaactcagagccgtgtttcaatccagaatagatgagatagactccgaactttcaaaa
cccgtcataaacgaagaagtttacaaaaaattgcataccaaaaacatgatcaaaaaatcc
aaaaaagtgaagcagatattcttttctcgtcctccacctctattatgtgttcatataaac
agatcggtttttgatcctaacacctatatgatacgaaagaacaatgccaaagttgttttt
tctgaaagactagacctctccaactatgtggccgtgccagatgatgttaacatggatgcc
agactgagtttcagaaaacaagatcaaggaaaagaaaaatcctggacacaagagttttca
gaagaagagcacgggattcaagatcaagatgaagatgacgttactgatgttggcccatta
acatattctttaaagtcaatcatctgtcattatggtactcataactatggtcattatatt
gctttcagaaagtatagaggcgtttggtggcgtatttctgatgaaacggtgacagtttcc
gatcttcaagaagtactgaatacgtcgggtactttcatgatgttttatgagctcagccaa
aggaatgatgatagggacactataaagtctatagatttcaacaacgtcgagatcacagac
ccctctgaagaggtcaaaggacaggagactgatcacagaacaagatccaaccaattaaca
acctctgatgtcgatattgatggccttccttctgatcttgaggcagatgaagcagaggag
cattctgactccgagtcgccatcggagtctgagtcagatcaagaatccgaatatcaacaa
caattggattctggtgaaagcataataggtaactacaacaacgatacagagaatacctct
tctgaagaaaaggtggatcaagcattgttacaagctaatctataa

DBGET integrated database retrieval system