KEGG   Pichia pastoris: PAS_chr2-2_0219Help
Entry
PAS_chr2-2_0219   CDS       T01092                                 

Definition
Guanylate kinase, converts GMP to GDP
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ppa  Pichia pastoris
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ppa00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1979032..1979592)
Genome map
AA seq 186 aa AA seqDB search
MARPIVISGPSGTGKSTLLKRLFAEFPSKYGFSVSNTTRSPRPGEENGVHYNFCSVDEFE
SLIKENAFIEWAKFSGNYYGTTIKAVDDVSRKLGKTCILDIDMQGVKSVKNTNLNARFLF
LAPPSIEELQKRLVSRGTETEESIRKRLDAAKAELEYAETGAHDKVIVNDDLEKAYQELR
AFVLEE
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtccaatagttatttctggcccctctggcacgggtaaatctacactcttgaaa
aggctgtttgctgaatttccaagtaaatatggattttctgtttcaaacaccacgagaagt
cctcgtcctggtgaagagaacggagttcattacaacttttgttctgttgacgagtttgag
tctctgatcaaggaaaacgccttcatagaatgggccaagttttccgggaactactatgga
actacgattaaggctgtggatgatgtttcacgcaaattgggaaagacttgcattttggat
attgatatgcaaggtgtcaagagtgtaaagaacaccaacttgaatgcccgttttctgttc
ctagctcctccttccattgaagaattgcaaaagcgtttggtaagtagaggcactgagaca
gaagagagtattcgcaaaagattagacgctgccaaagctgagttagaatatgctgagacg
ggagctcatgacaaagttattgtcaacgacgacctggagaaagcatatcaagagttgagg
gcatttgttctagaagagtaa

DBGET integrated database retrieval system