KEGG   Komagataella pastoris: PAS_chr2-2_0270Help
Entry
PAS_chr2-2_0270   CDS       T01092                                 

Definition
Essential structural subunit of the nuclear pore complex (NPC)
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ppa  Komagataella pastoris
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PAS_chr2-2_0270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1884518..1889458
Genome map
AA seq 1646 aa AA seqDB search
MSKEWSNIPFITLYDAIEGNQAELVASALSELKQDLTNLLLYPPKSDSSRKSLESGKVKF
TSGDEYELNKEFIIATVQLSDELNLDELIAAEINYNVSVTDEAQLVNSLFDGGKASFYMR
RRFILLIVSYLTNVSDFGSHFVAKELVDNLLKSYEVIERELESIKQLVARTKILNGNIVP
RIIQDGVDFRRNFLFKEHQLLGEIIHGVANNNFSTITTDHFKTFVSRISAIEENDVFSLS
YIPIVFDYFSHLNELPDSVVEELHSTYLKELEKENVSVTLALVVLVFLIYFVNWCKEKDS
GTTKYEFSSSVQNPLLKCIEIGALEKFMAITIILSRVDNSTTFFDFQSLLQNHIPELTAQ
RLSDDEGSKIEVILEDNFKELLVSILNTFIQDFISNGAFLLTHLRNTEEDILLANEDILE
DLDTLAENADLERFYLSVYYLYYDRPNICTQFWLDKDSNAYGFLKWASVCNSPLISSTYC
LMLSGLSSGEANSVETFNFLTQQNSQNIVSGPGLNSRISWKTIYEALNYYNKALLENGSN
SITPGVFSQNFQESVIPELGEDSVIFIAGYFQLISSIANNSEITKLKLFENDLLKMLFEF
LESATQITAPTLLVLRSLIGTNIESRHTIWRAIDNWIFNFPMNRHYLSSTKSFVAKDVFF
LSLRTFDEINAFVGLIEALLRPVQTEDTTLLDLTFPFDLGSTTRKNGVWSYLEFFAEELL
VNSNKDLLAPKSRIALQTSLLKCFKHCLTFFDNQVIISAQVCGLQNLNSIVKCKDFFKFI
SNEPGSIVTYYLYEKKVYDVLLDIASLGIDELTVKNESSKEAKLLYLSLEVIDLLLEKEP
LYLDEVVPLMKKSNMDLGTRGLSSFYDTFLFRLPVLIHIGLYIGSQHLSIARKSLQILSK
ISLSPQFSAGSSFSSVVKKNRLLSTFETVDESIRLRNSIIDQLENPNSLALKIEILEFLN
NNLSSAESTVSHFFIGFDTRNSLGLGNTQDLGTIASTRSTLKTLVLILVDTLEVLTEGKN
IPYNAIRILKLIFDIVLRLLKNSNTSSLITGFLRNDLPFNFFKKICIFEPKIDVQTQWDG
LLLDPALSLSNTFICESYGAGALLAFISQRALLLELLSLELHNIASTGSISARKSYVDPL
IGSSELNHGFPRILDFLDFLNLNLVNKLDPLDSYYRRFDFDYILKTLKLKTITLDGDERK
SIFELNSLNQMVELVHLEEGDKSSSTFEERRNYLVNYFSNSIFYTNFKEQQFRTLHAWVT
LVQIIVNEGNLTHAERSNFILEVFQSIVPRINDYIDIDIQYTEELMTLVLLLVDSYEKDR
KSFFTNNETSETTNSLIDSSRLYPLFKISIDTILSPLSTGMLRSKAYVLISKFLNYSEIN
KGVCTEALISIRSHDAKLLSLVCNDSIMGEGEPRITSMLLLDALVKISSRFEKNSLQSNF
VMDHMIKTNFFLMLIRSIKRTDEIFGLCFSKKGPTKVPLDVLLYELTAFKTTIYFLIRVA
KTKTGAQQLVNGDVFGVIKGCKFLSIDPDLGVELQLVENHDQTVRLRLSLDSPLNVSSAV
GDKISYFELLVPVFQLTLAVVISLAGTNQNAVNQVQGVMKHFKTLVVGVLKREVLIEKEA
SQAPNPENYQGLKQLSLLFTQLNSIL
NT seq 4941 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagaatggtctaatattccattcattaccctttatgatgcaatcgaggggaac
caggccgaacttgtagcctctgctttgtccgagcttaagcaggatctgacaaatctcctg
ctttatcctcccaaatcagactctagcaggaaatctctggagtctggaaaagtcaagttc
acctcgggcgatgagtatgaactaaacaaagaattcataatcgccactgttcaattgagc
gacgaactcaacctggatgagctaatagcagcggagataaattacaacgtcagtgttaca
gacgaagctcaactagtaaactctctcttcgatggtggaaaagcttcattctatatgagg
cgtagattcatattgctgatcgtctcatacttgaccaatgtgtcagattttggttctcat
tttgttgccaaggaattggttgataatttgctgaaatcctacgaggtaatcgaaagagaa
ctagaatccataaaacaattggtagctagaaccaagatcctaaacgggaacatagttcca
agaataattcaagacggtgttgacttcagaagaaattttttgtttaaagagcatcaactg
ttgggggaaatcattcatggagtcgcaaataataatttttcaaccatcacaaccgatcac
ttcaaaacttttgtttcccgcatttctgccatagaagagaatgatgtcttctcgctatca
tacattcctattgtcttcgactactttagccatttgaacgagcttccagattcagtggtt
gaagagctccattcaacttacttgaaagagttagagaaggaaaatgttagcgtcaccttg
gcattggtcgtactagttttcttgatatacttcgtcaattggtgtaaagaaaaggattca
ggaactacaaaatatgagttttcgtcaagtgttcaaaaccccctgttgaaatgcattgaa
ataggagctctggaaaagtttatggccattacgataattctttcaagagttgataacagc
accacattttttgattttcagtccctgctacagaatcacatacccgaacttacggcacag
cgattatcggatgacgaaggtagcaagatagaagtgattctagaggataatttcaaggag
cttttagtctcaattttgaacacttttattcaagatttcatttccaacggagcattttta
ttaacacatctaagaaacacagaagaggatatccttttggctaacgaggacatattggaa
gatttagatactttggctgagaatgctgatcttgaacgattctatctttctgtttactat
ctttactatgatcgcccaaatatctgcacgcagttttggctagacaaagactccaatgcg
tatgggtttttgaaatgggcttcagtctgcaactcgcctttgattagttccacttactgc
ctgatgttatccggactatcttcaggagaagcaaacagcgttgagacattcaacttcttg
actcaacaaaactcacagaatattgtctccggccctggacttaattcacgtattagttgg
aaaacaatttatgaggcactgaactattataacaaggcattactagagaatggctccaac
agtataactcctggagtgttttctcaaaattttcaagaatcagtgatcccagaattagga
gaagactcagtcatctttattgccggatattttcagttaatctcatctattgcaaacaat
agtgaaatcaccaagctaaaattatttgaaaatgacttgcttaagatgctgtttgaattt
ttggagtctgctactcaaatcaccgctcctacattgctagttctacgctcattgatcgga
acaaacatagaaagcaggcataccatttggagagctatcgataattggatttttaatttt
cctatgaataggcattaccttagcagtacgaagagttttgtggctaaggatgtgtttttc
ttatctctcagaacatttgacgaaattaatgcttttgttggcctaattgaagcattgtta
agaccagtccaaacagaagacacgacgctgttagatctgacttttccatttgatttgggg
tcaacaactcgaaagaatggagtatggtcttacctggaattctttgctgaggaattactg
gtcaattccaataaagatcttcttgccccaaagagtcgtatcgcacttcagacctcgtta
ttaaaatgttttaagcattgtctaacgtttttcgataatcaagttattattagtgctcaa
gtgtgtggcctacagaatctcaactccatcgtcaaatgcaaggatttttttaagttcata
agcaacgaaccaggatcaattgttacgtattacttgtacgagaaaaaagtttatgatgtt
ctcctcgatattgcttcattgggaatcgatgaattaacggttaaaaatgagtctagcaaa
gaggcaaaattactttacttgagtttagaagttattgatctgttattagaaaaagaacca
ttatatcttgatgaagttgttccattgatgaagaaatcaaacatggatcttggtactcga
ggattgagttctttttatgatacatttttgttcaggctacctgttttgattcacattggt
ctttatattggatcgcaacacttatcaatcgcaagaaaatcactacaaatccttagtaag
atatcactgtctccacagttctctgctggttcttccttctcatccgtggtgaaaaagaat
cgactactttctacttttgaaactgtggacgaatcaattagactccgcaattccataatt
gatcagttggagaacccaaattctttggcattaaagattgaaattttagaatttctgaac
aacaacttgagctctgcagagtctactgtttctcatttttttattggttttgataccaga
aattctttaggattgggtaatacccaggacctcggaactattgcgtccacaagatcgaca
cttaaaaccttagtattaatactggtagatactttggaagtgttaacagaaggcaagaac
attccctacaatgcgattagaatcctgaaattaatttttgatattgtgttgcgactgtta
aaaaattccaacacgtccagcttgattacaggtttcctgagaaacgatctgcctttcaat
tttttcaagaaaatatgtatttttgaaccgaaaattgacgtccaaacacaatgggatggt
ctattgctcgatccagctctgtcgctatcaaacactttcatctgtgaaagttacggagca
ggcgcattgcttgcctttattagtcagagagcgttgttgcttgagcttttatcgcttgag
ctgcacaatatagcgtccactggatctatttctgcaagaaagagctatgttgatccgcta
attggatcaagtgaactcaatcatggattcccaagaatcttggattttttggatttcttg
aacttgaatcttgtcaataaactggacccattagatagttattatcgccgttttgacttt
gattacattctgaaaacattgaagcttaaaacgattacactagatggtgatgaacgcaag
agcatttttgaattaaattcgttgaaccaaatggtagaattggttcatttggaagaaggc
gacaaatcttcatctacgttcgaagaacgacgaaactatctggttaactatttctccaac
agcattttctacactaattttaaggaacaacaattcaggacgctccatgcatgggttact
ctggtccagattattgttaatgaaggtaatttaacacacgcggaaagatcaaactttatc
ctggaagtatttcaatccattgtgcccagaatcaacgattatattgacatcgatattcag
tacacagaggaactaatgacattggtgttactgttggtggattcgtatgaaaaggaccga
aaatcatttttcactaataatgagacgagtgagaccacaaactcacttattgattcatct
aggctttatcctttgtttaagatttcaatcgacacaatactaagtccgttgtccaccgga
atgcttagatccaaagcctatgtgttgattagcaaattcctcaactattcagaaattaat
aagggagtttgtacggaagcattgatatctattcggtcacacgatgcaaaacttttatcg
ttggtttgtaatgactctatcatgggcgaaggtgaacctcgcattacttctatgctgttg
cttgatgcattagtaaagatatcatcgagatttgaaaagaattcgttacaaagcaatttt
gtgatggaccatatgattaaaaccaacttttttttgatgctgattcgaagcatcaaacga
actgacgaaatatttggtttgtgcttttccaagaaaggacctacaaaagtccctttggat
gttcttctatacgagttaactgctttcaaaactacgatatacttcttgattcgagtcgcc
aaaacaaaaacaggagcacagcagcttgtgaatggagacgtctttggggtgataaaaggc
tgcaaattcctttctattgatccagacttgggtgtggagttgcaattggtggaaaatcat
gatcagactgtcaggctccgcctttcgctggattcaccattgaacgtttcgtcagctgta
ggagacaaaatttcttattttgagttgcttgtgcctgtttttcaactcactttggctgtt
gtcatatctctagcaggtaccaaccaaaatgcagtcaaccaagttcaaggagttatgaag
catttcaaaactttggtagttggtgttctgaaaagagaagtcctgattgaaaaagaagcc
tcccaggctccaaatccagaaaattatcaagggttgaaacagttatctttgctgttcacc
caattaaacagcattttgtag

DBGET integrated database retrieval system