KEGG   Komagataella pastoris: PAS_chr2-2_0279Help
Entry
PAS_chr2-2_0279   CDS       T01092                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ppa  Komagataella pastoris
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PAS_chr2-2_0279
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    PAS_chr2-2_0279
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     PAS_chr2-2_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1868186..1869103
Genome map
AA seq 305 aa AA seqDB search
MSYLSDSTYGKDNVKFLKVKKDPRNPKIHEVMEATVRVLLTGAFDESYTEADNSSIVPTD
TVKNTILVEAKKFDIWPIENFAAHLAKHFINKYSWVSAVDVSIHQHRWTRISRENGASKT
YDHSFLKDGDELRLSTLQYSRNGTFKLSSGVKDLTVLKSTGSMFYGYNECDYTTLKPTKD
RILSTDVDATWVWDSKKLGSINNINTLAKHGVFDDAFEAARKVTLDLFATENSPSVQNTM
YKMAQKILDLVPDLENVTYSLPNKHYFLFDFSFQGLENDNELFYPSPHPNGLIKCTVART
PKSKL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatctatcagattctacctacggtaaggacaacgtcaaattcctcaaggtcaag
aaggatccacgcaacccaaagatccatgaggtcatggaagcaaccgttcgtgtccttcta
actggtgcctttgacgagtcttacaccgaggctgacaactcatccatcgttcctactgat
acagtcaagaacaccatcttggtcgaggccaagaagttcgatatctggccaatcgaaaac
tttgccgcacatttggccaagcactttattaacaagtacagctgggtttccgctgtcgac
gtgtccatccaccagcaccgttggactcgtatctcacgtgagaacggagcctctaagact
tacgaccactctttcctgaaggatggagatgagctacgtttgtcaactttgcagtactct
cgaaacggcactttcaagctctcatccggagtcaaggatctcactgttttgaagagcact
ggatctatgttctacggatataacgaatgtgactacaccaccttaaagccaactaaggat
agaattttgtctactgatgtggatgccacctgggtttgggactccaagaaacttggaagc
atcaacaacatcaacactctcgcaaagcacggagtgttcgatgatgccttcgaagctgcc
aggaaagttaccttagaccttttcgccacagagaactctccatcggtacagaacactatg
tacaagatggcacagaagattttagacttagtgcccgaccttgagaacgtcacctactct
ttgcctaacaaacattacttcttgtttgacttttcattccagggtttggagaacgacaac
gagctattctacccatccccacatcccaacggattaatcaaatgcactgttgctcgtaca
cctaaatccaagctctag

DBGET integrated database retrieval system