KEGG   Pichia pastoris: PAS_chr2-2_0382Help
Entry
PAS_chr2-2_0382   CDS       T01092                                 

Definition
Thiol peroxidase that functions as a hydroperoxide receptor
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppa  Pichia pastoris
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ppa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ppa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1674449..1674934)
Genome map
AA seq 161 aa AA seqDB search
MSSFYDLAPLDKKGEPFPFEQLKGKVVLIVNVASKCGFTPQYTELEKLYKDHKDEGLTIV
GFPCNQFGHQEPGNDEEIGQFCQLNFGVTFPILKKIDVNGSEADPVYEFLKSKKSGLLGF
KGIKWNFEKFLIDKQGNVIERYSSLTKPSSIESKIEELLKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcattttatgatctggccccattagataagaaaggcgaaccttttcctttcgaa
caattaaaaggcaaagtggtgttgattgtgaatgttgcttctaagtgtgggtttactcca
caatataccgagttggaaaagctctacaaagaccacaaggacgagggattgactattgtc
ggatttccctgtaaccagtttggtcatcaggaaccaggaaatgatgaagaaattggacag
ttttgccagttgaattttggtgtaactttcccaattctaaaaaagattgatgtcaacggt
tcggaagctgatcctgtttacgaatttctcaagtcaaaaaagtctggtctcctcggattc
aaaggtattaagtggaactttgaaaaattcttgatcgataagcaaggaaacgttattgag
agatattcgtccttgactaagccctcatcgatcgagtccaagattgaagaactattaaag
aaatag

DBGET integrated database retrieval system