KEGG   Komagataella pastoris: PAS_chr2-2_0382Help
Entry
PAS_chr2-2_0382   CDS       T01092                                 

Definition
Thiol peroxidase that functions as a hydroperoxide receptor
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppa  Komagataella pastoris
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PAS_chr2-2_0382
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PAS_chr2-2_0382
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PAS_chr2-2_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1674449..1674934)
Genome map
AA seq 161 aa AA seqDB search
MSSFYDLAPLDKKGEPFPFEQLKGKVVLIVNVASKCGFTPQYTELEKLYKDHKDEGLTIV
GFPCNQFGHQEPGNDEEIGQFCQLNFGVTFPILKKIDVNGSEADPVYEFLKSKKSGLLGF
KGIKWNFEKFLIDKQGNVIERYSSLTKPSSIESKIEELLKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcattttatgatctggccccattagataagaaaggcgaaccttttcctttcgaa
caattaaaaggcaaagtggtgttgattgtgaatgttgcttctaagtgtgggtttactcca
caatataccgagttggaaaagctctacaaagaccacaaggacgagggattgactattgtc
ggatttccctgtaaccagtttggtcatcaggaaccaggaaatgatgaagaaattggacag
ttttgccagttgaattttggtgtaactttcccaattctaaaaaagattgatgtcaacggt
tcggaagctgatcctgtttacgaatttctcaagtcaaaaaagtctggtctcctcggattc
aaaggtattaagtggaactttgaaaaattcttgatcgataagcaaggaaacgttattgag
agatattcgtccttgactaagccctcatcgatcgagtccaagattgaagaactattaaag
aaatag

DBGET integrated database retrieval system