KEGG   Pichia pastoris: PAS_chr2-2_0437Help
Entry
PAS_chr2-2_0437   CDS       T01092                                 

Definition
Glycogen debranching enzyme containing glucanotranferase and alpha-1,6-amyloglucosidase activities
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ppa  Pichia pastoris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAS_chr2-2_0437
Enzymes [BR:ppa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PAS_chr2-2_0437
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     PAS_chr2-2_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1564268..1568845
Genome map
AA seq 1525 aa AA seqDB search
MTRAVFLKVDNFGAPVAGSSSGVITLPSAPLDPNYKEGDILLQLHIIIEAGSTIANKGDL
WHNVPSSFVKKFERDKFYQQKITCSLYEDTVIAIPIYKPGSFSYFISYQDEELDVQKTTR
QYYFISPPNIYINGSYLPFNNISLQSVVSKWMGNDLVAWERIFDKISKKGYNMIHFTPLQ
SRGESNSPYSIYDQLQFDPTIFNSETEVEQMVSRLHEEHGILSMTDVVWNHTANNSAWLR
SHPEAGYNRETSPHLISAIELDLRLKEFSNSMANHGYPTTIKSTDDILTIMDGIKVHVLG
DLKLWQFYVLDVRSHVAELREHWETSLQGNIKIGLPQDSYEDYSKLAEFVKDTCLTRPFH
LAERNANRLDISSFACILASILDTTEYSSEVENRATRILNEINLPQYKIYDEDSNEILEQ
LFNRIKYLRLEEHGPQLGEITTKTPLTEPYFTVFKDKNGKQWELANNGWIWGGNPLVDFA
SRQTKSYLRREVIIWGDCVKLRYGSGPDDSPYLWNRMVQYTQKCAKMFDGFRIDNCHSTP
LHVGEALLDAAREVNPNLYVVAELFSGSEELDILFVERLAICSLIREAMQAYSVGELSRL
LHRHGGGPIGSLRWLPLDEFSYPATKESQVITANAFIDKASEIPVPRVCFRNAPHALFMD
CTHDNEVPNQKRKVEDTLTTAALVSFCSCAVGSVYGYDECFPELLDLVNEKKLYNPSSNN
GIPYVKSRLSYIREFLSHQSLDHSENNEVHVHHEGQFVTVHRTNSKTGRGYFLIARTKFE
EGAHETLPTINLSGTRVNHEFSFSLRQKKDYDISFDPKYLPEVPVDLVELSPPQVSFNES
TKKSCITLPEFFPQGSITILSTLMESVDEELEKFTTTGAIEATEELSLIDLQAILYRCES
EERDASAGRDGTYDIPGHGRLVYAGLQGWISVLKDVIKKNDLAHPICEHLREGSWACDYV
TNRLNKFVELSQNPDAVNRFRKWLRFRMDRIKQVPYFLLPRYFCIVIGVAYEALRFRALS
LMSPMIQTGTRFLQNLSLVSVQMVGCMNSASLTPKEMIPSMAAGLPHFSYDYMRCWGRDI
FLSLRGLLLATGRYDEAKSHIVNCGKTLKHGLIPNLIGSGAEPRFNARDAVWFYAQSIQD
YVREVPNGHEILQEKVERRFLPFDDSWFPISDQRAYSVTSTIEELLYEILSRHASGISYR
EANAGPNLDSQMLNEGFNVRVTVDWNNGLIFGGNQYNCGTWMDKMGESESAGNKGIPGTP
RDGAAIEIIGLLKSTLQFVVDLQKRRLFKFSKVTNQHGNEVTFENWNALVAKNFERCFYV
PENPSDDGNYDLDSAIINRRGIYKDLYRSGKPYEDYQLRPNFCIAMCVAPELFTPSFALN
SLKKADILIRGPIGMSTLDPSDLNYRPYYNNSEDSTDFATAKGRNYHQGPEWVWLTGFFL
RAFRSYHLKEVDFCRNEKGDQSTHLDLLLSQRLSAHRSWIAESVWAGLTELTNRGGSYCP
DSSPTQAWSAATLIELYHDIYLHED
NT seq 4578 nt NT seq  +upstreamnt  +downstreamnt
atgacaagagctgtgtttctgaaagttgataattttggggctccagttgctggatcctcg
tcaggtgtgattaccttaccatctgctccattggaccccaattacaaagaaggagacatt
ttgctacaacttcatattataatagaagctggaagtaccatagccaataagggtgacttg
tggcacaatgtcccatcatcttttgttaaaaaatttgaaagagacaagttttaccagcag
aaaattacttgtagcctatacgaagatactgttattgctattccaatttacaaaccaggc
agtttctcctacttcatttcttaccaggatgaagaattagatgttcagaaaacaacccgc
caatattactttatttcgcctcccaatatctatataaacggttcctatctgcccttcaat
aatataagcctgcagtcggtagtgtctaagtggatgggtaatgatttagtggcatgggaa
cgaatattcgataagatttcaaaaaagggctacaatatgattcattttactccgttacaa
tcacgaggggaatcaaattcgccatattcaatatacgatcaacttcagtttgatccaacg
attttcaattctgaaacagaagttgaacaaatggtatctcggttacatgaggagcacggt
atcctttctatgactgacgtggtctggaaccacacagcaaataactcagcttggttgaga
tctcacccagaagctggttataatcgcgagacttctccacatcttatctcagcgattgag
ttagaccttcgcttgaaagaatttagtaacagtatggccaaccacgggtacccgactact
ataaaatccactgatgacatactaactatcatggatggaataaaagtacacgttctagga
gatctcaaattgtggcagttttatgttcttgatgttagaagccacgttgctgagttaaga
gaacactgggaaacaagtctccagggaaacatcaaaattgggctaccacaggattcttat
gaagactattctaaactagccgaattcgtcaaggatacatgtcttactcggccattccac
cttgcagagcgcaatgccaaccgcctagatattagctcctttgcgtgcattttggcttcc
attctcgatacgaccgaatactcttcagaggtagaaaatagggctactagaattttaaat
gagatcaacctcccacaatacaaaatctacgatgaagattctaacgaaattttagaacag
ttattcaataggattaagtaccttcgtcttgaggaacatgggcctcaacttggtgagata
acaactaaaactcctcttaccgagccctattttacggttttcaaggacaagaatggtaaa
cagtgggaactggccaacaatggctggatttggggcggtaaccctttggtagattttgct
tcgcgtcaaactaaatcatacttgcgaagagaggttattatctggggcgattgtgtcaaa
cttagatatgggagtggtccagacgattcgccttacttatggaataggatggttcaatac
actcagaaatgtgctaaaatgtttgatggatttcgtattgacaactgtcactcgacccct
ttacatgttggagaagccctacttgatgctgcaagagaagtcaatccaaatctttatgtt
gttgcagaactcttttcgggaagtgaagagttggacatactctttgtagaacgactggct
atttgctcattgataagggaagccatgcaagcttattcagtaggggaattatctagattg
cttcatcgccatggaggagggcctatcggctctctccgttggttaccattagatgagttc
tcataccctgcaaccaaagagtcccaggttattactgctaatgcttttattgacaaagcg
tccgagattcccgttcctcgtgtgtgttttaggaatgcgcctcatgctctttttatggac
tgtacacatgacaatgaggtgccgaaccaaaagagaaaagtcgaggacacgctgacaact
gcggccttagtatcattctgttcgtgtgctgtgggtagcgtgtatggttatgacgaatgt
ttccctgaactacttgatctcgttaacgaaaaaaaactttacaatccttcaagtaacaac
ggaataccttatgtaaagtcgaggttgagttatattagggagtttctgtctcaccaatca
ttggaccattctgaaaacaacgaggtgcatgttcaccacgaagggcaatttgttacggtg
catcgaactaattcaaaaactggccggggttacttcctcattgcccgaactaagtttgaa
gagggcgcacatgaaacgttacccacaattaaccttagtgggaccagagtgaaccacgag
ttttcgttttccctcagacaaaagaaagattatgatatttcttttgatccgaagtactta
cccgaagtcccagttgaccttgtagagttaagcccccctcaagtgagcttcaatgagtct
accaagaaatcttgtatcacactgcctgaattttttccacagggttcaataaccattcta
tctactctaatggaaagtgttgatgaggagttagagaaatttactactactggagcaatt
gaagctactgaagagttgtcgcttatagatctccaggcaatattataccgttgtgaatct
gaggaaagagacgcaagcgctggaagggatggtacctatgatataccgggacatggtcgt
ctggtttatgcaggccttcagggctggatcagcgttttgaaggatgttatcaagaagaac
gatctagcccatcctatttgcgagcatttgcgggaaggttcttgggcttgcgattatgtt
actaataggttgaacaaatttgtcgagttgagtcaaaatcctgatgccgtaaatcgcttt
agaaaatggcttcggttcagaatggatcgcatcaagcaagtgccctattttctactgccc
cgttatttttgcattgttatcggagtagcatacgaggcattgagatttcgggctctttcc
ttaatgtctcccatgatccaaacaggtacacggtttctgcaaaatctttctttggtctca
gttcaaatggtcggatgtatgaattcagcaagtctaaccccaaaagaaatgattccatca
atggcagctggtctaccgcattttagctatgattacatgcgatgttggggtagagatatt
tttctttccttgagagggcttcttttagctacaggaagatatgacgaggccaagtcgcat
atagttaactgtggaaaaacacttaaacatgggttgataccaaatttaataggatcgggc
gctgagccaagatttaatgctagagatgctgtatggttttatgcccaaagtattcaagat
tatgtgcgtgaggtcccaaatggtcatgaaattcttcaagagaaagtcgaaaggaggttt
ttaccgtttgacgactcttggtttccaatctccgaccagagagcttattcggtgacgtca
actattgaagaattactttacgaaattctttcgagacacgcttctgggatcagctatcgg
gaagccaatgcaggccccaacttagactctcagatgttgaatgagggtttcaatgtaagg
gtaaccgtggattggaataatggccttatctttggagggaaccagtataattgtggaact
tggatggacaagatgggagaaagtgaatcagcaggcaataaaggaatacccggtacccca
agagatggagcagcaatagagatcataggattgttgaagagtacacttcagtttgttgtt
gacctgcaaaaaaggcggttgtttaaattcagtaaagttacgaaccagcacggaaacgag
gtcacttttgagaactggaatgctttagtggccaaaaatttcgaacgttgtttttatgtt
cctgagaatccttctgatgatggcaactatgaccttgactcggctatcatcaacagaaga
gggatttataaggacttatatcggtctggaaaaccctatgaagattatcagttgagaccc
aacttttgcattgctatgtgtgttgctccagaactattcaccccgtcttttgcgctaaat
tctcttaagaaggcggatatacttattagaggccctataggcatgtcaacgctggatcct
tctgatttgaactatcgtccctactacaacaatagtgaagattcaacggattttgcaact
gcgaaaggacggaactaccatcaaggacctgaatgggtttggttaaccggtttctttttg
cgagctttcagatcttatcatcttaaggaggttgatttttgtaggaacgaaaaaggagat
caaagcactcatttagacttattactttcccagcggctgtctgcccataggagctggatt
gcagaaagcgtttgggcaggactcacagaattaaccaatagaggtggttcgtattgtccg
gactccagccccacgcaagcatggagtgcagccacgttgatcgaactttaccatgatatc
tatctgcatgaggattag

  All links  
No link information was found.   
DBGET integrated database retrieval system