KEGG   Pichia pastoris: PAS_chr3_0041Help
Entry
PAS_chr3_0041     CDS       T01092                                 

Definition
Middle sporulation-specific mitogen-activated protein kinase (MAPK) required for production of the O
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PAS_chr3_0041
Protein kinases [BR:ppa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PAS_chr3_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(89146..90312)
Genome map
AA seq 388 aa AA seqDB search
MISSQKPIGNKKADIEVAVKKEYSVYSKANFYLNSRYQVQQVLGKGSYGVVCSVLDLKSE
NPVPLAVKKVSNIFTREVLLRRAIRELKLMKFFRGHRNIINLVNLDIVYIKPYDGLYCFQ
ELVDYDLARVIHSNVQFSEFHIQSFLYQILCGVKYIHSADVIHRDLKPGNILVTVLGNLK
ICDFGLARGINHQFMQGSSRPRDNAITNYVATRWYRAPELIFSRKEYGKAVDMWAVGCIF
GELYGRKPLFIGDSQMSQIAEIVKVLGSPSKEVIMAYGSHLAWDYFQPPKPQYRPLKWAH
VYPYASGSALDLLSSLVCWEAKRRLDVEAALSHEFLSAVRNKSQEPKCKSIFDFRWEKEN
TSLEDLKILLHEEVTQFKNERENNSQPN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgatatcttctcaaaagccgattggtaacaagaaagccgatattgaggtcgctgttaag
aaagaatattcagtttactctaaagcaaacttttacctcaactcaaggtatcaagtccag
caagttttgggtaaaggttcttatggcgttgtatgttcagtgctagatttgaagtccgag
aacccggttccattagcagtcaagaaagtcagcaatatcttcactagagaagttctgctt
cgcagagccatccgagagttaaaattgatgaagttttttagaggtcaccgaaatataatc
aatctggtaaatcttgacattgtatacatcaagccctatgacggcctgtactgcttccaa
gagttggtggattatgatctggctcgtgtaattcattctaatgtgcagttcagcgagttt
cacattcaaagttttctctatcagattctctgcggagtcaagtacatccactccgctgat
gtaattcatagagacttaaaacctggaaacatcctggtaactgtattagggaacttgaaa
atatgcgatttcggtcttgcgagaggtataaatcatcaattcatgcaaggatcatcgagg
cccagggataacgctatcaccaactatgtggctactaggtggtaccgtgcgccggaatta
atattctccagaaaagagtacgggaaagctgtagatatgtgggctgtagggtgtattttt
ggcgaattgtatggtagaaaacctcttttcattggagactcgcagatgagccaaattgcg
gagattgtcaaggttttaggaagtccttccaaagaggtgatcatggcatacggatcacat
ctggcatgggattattttcaacctcccaagccacaatacaggccactgaagtgggctcat
gtttatccatacgcaagtggttcagcactagatcttctctcctcactcgtttgctgggaa
gctaagcgtagacttgatgtggaagcagcactatctcacgagttcttaagtgccgtcaga
aataaaagtcaagaaccaaagtgtaaatctatttttgactttcgatgggaaaaggagaac
acaagtctagaagatctgaagatcttgctgcacgaagaagtcactcaattcaagaatgaa
agggaaaataactcccaacctaattag

DBGET integrated database retrieval system