KEGG   Komagataella pastoris: PAS_chr3_0106Help
Entry
PAS_chr3_0106     CDS       T01092                                 

Definition
Profilin, actin-and phosphatidylinositol 4,5-bisphosphate-binding protein, involved in cytoskeleton
Orthology
K05759  
profilin
Organism
ppa  Komagataella pastoris
Brite
Exosome [BR:ppa04147]
 Exosomal proteins
  Proteins found in most exosomes
   PAS_chr3_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(join(218966..219333,219448..219460))
Genome map
AA seq 126 aa AA seqDB search
MSWNAYTDNLIATNKLDRAAIYSAAGDSQWATTNDLTLLPNEIQELVAGFKDPSGLQATG
LHIKGQKYFLLKNDERSIYGRHETEGIIAVKTKQAILIAHYPPGVEAGEATLIVEKLADY
LISVGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggaatgcttacaccgataacctcattgccaccaacaaactagatcgggctgcc
atctacagtgctgctggagactcgcagtgggctaccacaaatgatcttactcttctcccg
aacgaaatccaagaattggttgctggtttcaaagacccttcagggctgcaagctacagga
ttgcacatcaagggccagaaatactttcttttgaaaaatgatgagcgttccatctatgga
agacatgagactgagggtatcattgctgtcaaaactaagcaggccatcctgattgctcat
taccctccaggtgtggaagctggagaggctacattgattgtagaaaagttagctgattat
ttgatttctgtcggttactaa

DBGET integrated database retrieval system