KEGG   Pichia pastoris: PAS_chr3_0117Help
Entry
PAS_chr3_0117     CDS       T01092                                 

Definition
Ubiquitin-specific protease that removes ubiquitin from ubiquitinated proteins, cleaves at the C ter
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PAS_chr3_0117
Peptidases [BR:ppa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAS_chr3_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:238466..242308
Genome map
AA seq 1280 aa AA seqDB search
MPDQVPSASTNVNNPFAQLEAYDFSKSKIFKTSNRLIDDIKNSVLFLEQFSILNLPAVDY
ATQLSLQYQNRQINESFKLVLLNNQLDFAPTVSTEQLPNGTRTVFRGLIVQDTVHGIPIS
DIPIYHCRILFKSLENEILCSKHQFFHFSDDSLSPSDRSDLVTDYAKISKGELTDCEDDL
KPSIVQSCPKLLDSTNYICRKCYKVLRIEIFEKDLSNEEYKQFELNEIQFRYSKTVSADP
SLNISNENDVNKIPSQSECLWTLFKVLRGPLSRDPEELEVKTLDVNHKILNIHLDMDIFE
KCLFFHKSADGSYLTPPLFSEYGVFENLVRESYIRKLLEVVYLGTICPNNPGLKRLNQFA
QAYWFNDTGSKIFHFLKEFDSTAAIEWFGGLRYDVLERYNPALTTLVSANYFNNKLICGS
YSLLCESDPQNTPKYFDALRDIGLLRQAPVVQEFVAKEASKNVFSFRDTMRNYQILGIDT
SSADFPTLSDDEILKFYKYELILANSESSYDRLRNALSSIADYRKSEALQNYLRIEPIHN
IDQAYKHFDTPQSIEDDVLITAFQFKKDDFPQAVALYDRALLTIAIQRKSLFLWSYITHN
LDYLFKVIVASSSKTITGVEDAYKYLGCDPLATDFQVVTIFQERLIKDPGIDVILFFYSL
VVIEKSRSSKLIGKFLQNGVVDASFLPLESSPVGLNNIGNTCYLNSLLQYYFVIKPLRTA
IQNFKDILPSSEEEFNSIEDYSKRRIGGRTVGYKETERSFQFVYQLRDLFDELIHSRRIA
ITPTKELAYLAFSPSTDEVQFHLPEVQKPRPSITESETGMSDAPVPELSPVAMDWSSSIA
YPEPSSSHHEESAALNSPDESSELIHSPTKRKLSPQPSTEDLNEIDTKVSVTNAEPPTTT
LPKRATTAVALIGNDQLENALELGRQQDVTECIENVLFQLESASKPTSLDSDDQEQNDLV
KELFYGRTKQILQPVDKETKENITDSSVRTKVERFVSLLVNIGDHPKDLYDALDTYFTED
LIDLDDGQVKRSLTITELPKFLQIQVQRVQFDRERGIPFKALDPLPFHEKLYMDRYLETD
NEELILKRKEIFQWKNEISKLNRRKDEILVPSSHSMTPRNALIATKEFLEAQKELPGDIQ
ATESTLITLQKEIDILNSELQTINSRLSELEEKCQHQFDQFKNTGYSIFAIFIHRGEASY
GHYWVYIRDPTRNIYRKYNDETITEVPISEVFNFSESNTATPYFLVFVREDLEDEVEPLK
RELDSSPTTEDFRISVEELD
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atgccagatcaggttcccagtgctagcacaaatgtgaacaatccttttgcacaattggag
gcgtatgatttttcgaaatccaaaattttcaagacttccaatcgattaattgatgatatc
aagaacagtgtgctgtttctagagcagttctccatattgaacctcccagctgttgattat
gccacccaattatccttacagtatcaaaacaggcagataaatgagtctttcaagttagta
cttttgaacaatcaattagactttgctccgactgtgtctacggagcaactaccaaatgga
acaaggaccgttttccgcggactcatagtacaggacactgttcatggcataccaatctca
gacatacctatctatcattgcagaatactgttcaagagcttggagaatgagatactttgt
tctaagcatcaattttttcatttttctgacgattccctcagcccatcagatcgttccgat
ctggtcacagactatgcaaagatatccaaaggtgagttaaccgactgtgaagatgatctc
aagccttcaattgttcaatcatgccccaaactactagactccaccaactatatttgtcga
aaatgttacaaagttttaaggatagagatttttgagaaggacctatccaatgaagagtac
aaacagtttgagttgaacgagatccagttcagatacagcaaaacggtttctgcagacccc
tctttgaatatttctaatgagaacgacgtcaataagataccctcccaatcagagtgttta
tggactctattcaaggtcttgcgaggcccattaagtcgtgatcccgaggagttggaagtt
aaaactctggatgtgaatcacaaaattctgaatatacacctagacatggacatttttgag
aaatgcctttttttccacaagtctgcagatggaagctatttgacgccgcctttattttcc
gagtatggagtgttcgaaaatctagtaagggaatcttacatccgaaagttactggaagtt
gtgtacctgggtacaatttgccccaacaatccggggctgaagcgacttaaccagtttgcc
caagcatattggtttaacgatactggctctaaaatatttcatttcttgaaggagtttgat
tctactgcggcaatcgaatggtttggtggtttgagatatgatgttttagaacgctacaac
ccggctttaacaaccttggtttcggcaaattatttcaataacaaacttatctgtggtagc
tatagcttactctgcgaatctgatccgcagaacactcccaaatattttgatgccttgaga
gatattggtcttcttagacaggccccagtagtgcaagaatttgttgccaaagaagctagc
aagaacgttttcagtttcagggatactatgagaaattatcaaatacttggaattgacact
tcctctgctgattttccgacattaagtgatgatgaaatcttaaagttctacaaatacgag
ttgatcctcgctaactcagaatcaagctacgacagactgcgaaatgcgttatccagcatt
gcagactatcgcaaaagcgaagctttacagaactatcttcgtattgaacctattcataac
attgaccaggcatataaacattttgacactccacaaagcatagaggacgacgtgcttatt
actgcattccaattcaagaaggatgattttcctcaagcagttgctctttatgaccgagct
ctacttaccatagcaattcagagaaaaagtctatttttgtggtcatacatcacccataac
ttggactatcttttcaaggttatagttgcatcatctagtaagacaataacaggtgttgag
gatgcgtacaaatatctcggctgtgatccattagcaacagatttccaagttgtcacaata
tttcaggagagactgattaaggatccaggtattgatgtgatactttttttctattctttg
gtagtgatagaaaaatctagaagcagtaaacttatcggcaaatttctccaaaatggtgtc
gttgatgcttccttcttgcctttagagagttcaccagttggcctgaacaatattggtaat
acatgttatttgaactctttacttcaatattattttgtgataaaaccattaagaactgcg
attcaaaatttcaaggatatcttaccttcaagcgaagaggagtttaatagtatagaagac
tattctaagagaagaattggtggtcgtactgttggatataaggaaaccgaaagatctttt
cagtttgtttaccaattacgtgatctatttgatgagttgatacactcccgtcgtatagcc
attacacctaccaaagagctagcttatctagccttttctccgagtactgatgaggttcag
tttcatttaccagaagtacaaaaaccaagaccaagtataactgaatctgaaactggaatg
agcgatgctcctgtgcccgagctttcaccagtagcaatggactggagttcctctattgct
tatcccgaaccatcatcttctcaccatgaagaatcagcagcattgaactctcctgacgag
tccagtgagcttatacattcaccaacaaagcgaaagctgtcacctcaaccttctaccgag
gacttgaatgaaattgataccaaagtttctgttactaacgcagagccaccgacgactact
ttacctaagagagctactacggctgttgctctgattggaaatgaccaactggagaatgcg
cttgaattaggtagacagcaagatgttacagaatgtattgaaaatgttctatttcaacta
gagagtgcttctaaacctacttccttggattccgatgaccaagaacagaatgatcttgtg
aaagaactgttttatggtagaacgaagcaaattttgcagccagtggataaagaaaccaaa
gagaacattactgactcgtcagtgagaaccaaagttgaaagatttgtaagcttacttgtc
aatatcggggatcaccccaaggatctctacgatgcattagacacttattttactgaagat
ttaattgatttagatgacggacaagtcaagaggtctcttacaatcaccgagcttccaaaa
ttcttgcaaatccaagttcagagagtccaatttgatcgtgaaaggggaattccattcaaa
gccttggatcccttgcccttccatgaaaagttgtacatggacagatacctggaaaccgat
aacgaagagttaattttgaaacggaaggagatttttcagtggaaaaatgagatcagtaag
ctcaacaggcgtaaggacgaaattcttgtaccaagttctcactctatgactccaagaaat
gctttgattgcgactaaagaatttttagaggctcagaaggagttacctggagatattcaa
gctaccgaatcaacgcttatcactttacagaaagaaattgatatattaaatagtgagctc
cagactattaactcaagactttctgagttggaagaaaaatgtcagcatcaattcgaccag
tttaagaacactggttattccatttttgccattttcattcatagaggcgaagccagctat
ggtcattattgggtctacatcagagacccaactagaaatatttaccgaaagtataatgat
gaaacaatcactgaagttccaatttcagaagtgttcaatttttctgagtcaaatactgct
actccatactttttggtatttgttcgggaagatttggaggatgaggttgaaccactcaaa
agagagctggacagctcccctacaaccgaggattttagaatatctgtagaagaactagat
tag

DBGET integrated database retrieval system