KEGG   Pichia pastoris: PAS_chr3_0228Help
Entry
PAS_chr3_0228     CDS       T01092                                 

Definition
Catalytic subunit of the Hat1p-Hat2p histone acetyltransferase complex
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAS_chr3_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(460386..461516)
Genome map
AA seq 376 aa AA seqDB search
MTDLSSLDPNIYTSSSNEALSISLAGNGKAVSFHPDFTYPIFGDAEQIFGYKDLVIHLVF
DSMSLYPFLNVRYSEKRDDADEVESKLLELLPEETVVKDEALWQDKIDGENFEIPGEILS
TYTHKDENYHVYKLSINKCAESLQLHRRMQIFVLFFIEAGSYIDAKDDMWEIYVVYKEDK
TFIGFATGYSYWKYPGHEIFDSDAKYLWRKKISQFVILPPYQGQSHGSQLYKTIFEQWFK
DDQVAEITVEDPSEAFDDLRDRCDLERLYQRGLLETLPEPVISPEWFQTQQAKEKIEKRQ
FQRCVEMLLLHALKSKKNTRLQIKKRLFIKNRDALLDLDEATRKDKLQVAYERLEEDYQR
ILEKVRFVKKRPHQDT
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgactgatctgtcgtcgttggatcccaatatttatacctcctcatcgaatgaggcactg
tcaatttcattggctggtaacggaaaagctgtgtcgtttcatcctgactttacgtatccc
atatttggcgacgcggaacaaatttttgggtacaaggacctggtaatacatctggtattt
gacagcatgtcattgtatccctttttgaatgtcaggtacagtgagaagagagatgatgct
gatgaagtggagtccaagttgttggagttgttaccagaggaaactgttgtgaaagatgaa
gcgttatggcaggacaaaatcgatggagaaaactttgaaatccccggtgaaatattatca
acttacactcacaaggatgaaaattatcacgtatacaaactctcaatcaataaatgtgcc
gagagccttcaattgcaccgtcgtatgcaaatcttcgtgttattttttatcgaagcaggc
tcctatatcgatgcaaaggatgacatgtgggagatttatgttgtttacaaagaggacaag
acgttcattggatttgccaccggatactcgtattggaagtatcctggccatgaaatcttc
gactccgatgcgaaatacctttggagaaagaagatctcacagtttgttatcttacctcca
taccaaggacaatctcacggaagccaactttacaagacgatatttgaacaatggttcaag
gatgaccaagtggcagaaattactgtcgaagaccctagtgaggcatttgacgatctaagg
gacagatgtgatctggagagactttatcaaagagggttgttggaaacattaccggaacca
gtaatctctcccgaatggtttcaaacacagcaagcaaaagagaaaatagagaagagacag
ttccagcggtgtgttgaaatgctcttattacacgccttgaaatcaaagaaaaacacccgt
cttcaaataaaaaagagacttttcatcaagaacagagacgcactcttggacctcgacgaa
gccaccagaaaggacaaactgcaagttgcttatgaacgcttagaagaagactaccagaga
atattggaaaaagttagatttgtcaaaaaacgacctcatcaggacacttaa

DBGET integrated database retrieval system