KEGG   Pichia pastoris: PAS_chr3_0294Help
Entry
PAS_chr3_0294     CDS       T01092                                 

Definition
Gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ppa  Pichia pastoris
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAS_chr3_0294
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PAS_chr3_0294
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PAS_chr3_0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:581935..583290
Genome map
AA seq 451 aa AA seqDB search
MGENCYTIVVKLGTSSVVDEETREPRIATMSRIVETLVKLRRKGHRIVIVSSGAIAVGMK
RVNMKRKPKKLQQVQALAAIGQGRLIGLWDDLFRQLNQPIAQILLTRTDLVDYTQFKNAE
NTLEQLIKMGIIPIVNENDTLSIQEIKFGDNDTLSAITAGMCHADYLFLVTDVDCLYTDN
PRTNPDAEPIVLVRNMRNLNVNTESGGSAVGTGGMTTKLIAADLGVSAGVTTIICKSEHP
EQILDIVEYSIRADRVENEAKYLVINEEETVEQFQEINRSELRELNKLDIPLHTRFVGHS
FNAVNNKEFWLLHGLKANGAIIIDPGCYKAITRKNKAGILPAGIISVEGNFHEYECVDVK
VGLRDPDDPHSLDPNEELYVVGRARCNYPSNQINKIKGLQSSQIEQVLGYADGEYVVHRD
NLAFPVFADPELLDVVESTLSEQERESKPNK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaaattgttacactatcgtcgttaaattgggaaccagttccgtggtagatgaa
gaaaccagggaaccaagaatcgcaactatgtctcgtattgtcgagacccttgttaagctg
cgaaggaagggccatcgaattgtcatcgtctcctcaggtgccatcgctgtgggcatgaag
agagtcaacatgaagcggaaaccaaaaaagttacagcaagtgcaggcattggctgctata
ggacaaggccgtttgataggactttgggacgaccttttccgtcagttgaatcagcctatt
gcgcagattttactgactagaacggatttggtcgattacacccagtttaagaacgctgaa
aatacattggaacagcttattaaaatgggtattattcctattgtcaatgagaatgacacc
ctatccattcaagaaatcaaatttggtgacaatgacaccttatccgccataacagctggt
atgtgtcatgcagactacctgtttttggtgactgatgtggactgtctttacacggataac
cctcgtacgaatccggacgctgagccaatcgtgttagttagaaatatgaggaatctaaac
gtcaataccgaaagtggaggttccgccgtaggaacaggaggaatgacaactaaattgatc
gcagctgatttgggtgtatctgcaggtgttacaacgattatttgcaaaagtgaacatccc
gagcagattttggacattgtagagtacagtatccgtgctgatagagtcgaaaatgaggct
aaatatctggtcatcaacgaagaggaaactgtggaacaatttcaagagatcaatcggtca
gaactgagggagttgaacaagctggacattcctttgcatacacgtttcgttggccacagt
tttaatgctgttaataacaaagagttttggttactccatggactaaaggccaacggagcc
attatcattgatccaggttgttataaggctatcactagaaaaaacaaagctggtattctt
ccagctggaattatttccgtagagggtaatttccatgaatacgagtgtgttgatgttaag
gtaggactaagagatccagatgacccacattcactagaccccaatgaagaactttacgtc
gttggccgtgcccgttgtaattaccccagcaatcaaatcaacaaaattaagggtctacaa
agctcgcagatcgagcaggttctaggttacgctgacggtgagtatgttgttcacagggac
aacttggctttcccagtatttgccgatccagaactgttggatgttgttgagagtaccctg
tctgaacaggagagagaatccaaaccaaataaatag

DBGET integrated database retrieval system