KEGG   Pichia pastoris: PAS_chr3_0294Help
Entry
PAS_chr3_0294     CDS       T01092                                 

Definition
Gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ppa  Pichia pastoris
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppa00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:581935..583290
Genome map
AA seq 451 aa AA seqDB search
MGENCYTIVVKLGTSSVVDEETREPRIATMSRIVETLVKLRRKGHRIVIVSSGAIAVGMK
RVNMKRKPKKLQQVQALAAIGQGRLIGLWDDLFRQLNQPIAQILLTRTDLVDYTQFKNAE
NTLEQLIKMGIIPIVNENDTLSIQEIKFGDNDTLSAITAGMCHADYLFLVTDVDCLYTDN
PRTNPDAEPIVLVRNMRNLNVNTESGGSAVGTGGMTTKLIAADLGVSAGVTTIICKSEHP
EQILDIVEYSIRADRVENEAKYLVINEEETVEQFQEINRSELRELNKLDIPLHTRFVGHS
FNAVNNKEFWLLHGLKANGAIIIDPGCYKAITRKNKAGILPAGIISVEGNFHEYECVDVK
VGLRDPDDPHSLDPNEELYVVGRARCNYPSNQINKIKGLQSSQIEQVLGYADGEYVVHRD
NLAFPVFADPELLDVVESTLSEQERESKPNK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaaattgttacactatcgtcgttaaattgggaaccagttccgtggtagatgaa
gaaaccagggaaccaagaatcgcaactatgtctcgtattgtcgagacccttgttaagctg
cgaaggaagggccatcgaattgtcatcgtctcctcaggtgccatcgctgtgggcatgaag
agagtcaacatgaagcggaaaccaaaaaagttacagcaagtgcaggcattggctgctata
ggacaaggccgtttgataggactttgggacgaccttttccgtcagttgaatcagcctatt
gcgcagattttactgactagaacggatttggtcgattacacccagtttaagaacgctgaa
aatacattggaacagcttattaaaatgggtattattcctattgtcaatgagaatgacacc
ctatccattcaagaaatcaaatttggtgacaatgacaccttatccgccataacagctggt
atgtgtcatgcagactacctgtttttggtgactgatgtggactgtctttacacggataac
cctcgtacgaatccggacgctgagccaatcgtgttagttagaaatatgaggaatctaaac
gtcaataccgaaagtggaggttccgccgtaggaacaggaggaatgacaactaaattgatc
gcagctgatttgggtgtatctgcaggtgttacaacgattatttgcaaaagtgaacatccc
gagcagattttggacattgtagagtacagtatccgtgctgatagagtcgaaaatgaggct
aaatatctggtcatcaacgaagaggaaactgtggaacaatttcaagagatcaatcggtca
gaactgagggagttgaacaagctggacattcctttgcatacacgtttcgttggccacagt
tttaatgctgttaataacaaagagttttggttactccatggactaaaggccaacggagcc
attatcattgatccaggttgttataaggctatcactagaaaaaacaaagctggtattctt
ccagctggaattatttccgtagagggtaatttccatgaatacgagtgtgttgatgttaag
gtaggactaagagatccagatgacccacattcactagaccccaatgaagaactttacgtc
gttggccgtgcccgttgtaattaccccagcaatcaaatcaacaaaattaagggtctacaa
agctcgcagatcgagcaggttctaggttacgctgacggtgagtatgttgttcacagggac
aacttggctttcccagtatttgccgatccagaactgttggatgttgttgagagtaccctg
tctgaacaggagagagaatccaaaccaaataaatag

DBGET integrated database retrieval system