KEGG   Pichia pastoris: PAS_chr3_0345Help
Entry
PAS_chr3_0345     CDS       T01092                                 

Definition
Histone acetyltransferase (HAT) catalytic subunit of the SAS complex (Sas2p-Sas4p-Sas5p)
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAS_chr3_0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:679743..680726
Genome map
AA seq 327 aa AA seqDB search
MSDNEGYYGVTQKRNIRRVRLGDNEFDTLYGNSVYFLEGHHDMLGYEAVNAHQRIHHRKH
SEPQINGDTDSYWLDTLYVCDLCFKYTRDEALLNSHLSVCKHNYRFPGKTMYKDNFTIKK
VSGYRHTILCQNLCLFAKLFLDSKSVYFSIENFDFYVVLGESNGRRVPMGFFSKELLSWD
ENNLACILIFPPFQRKRLGHLLIEFSYELSRFEGKVSGPEFPLSAFGKIGYLKYWSKVIC
RELLYGRFSDCQSITLQKLSKFTCIRVKDLISTLDYMGSWFTTSDIENSKSLDQYPLAIS
RSVLKQWIKGESSNCQKLIQEDSLVLY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataatgaaggctattacggagttacacagaagagaaacataagaagggtaaga
ctcggtgataacgagtttgatactttgtacggtaatagtgtttatttcttggagggtcac
cacgatatgttaggatatgaggcagttaatgcccatcaaagaatacatcacaggaagcat
tcagagccacagataaatggggacacagattcatactggctagatacgctctatgtttgt
gatctatgtttcaagtacaccagagatgaggcattactgaacagtcatctgtctgtttgc
aagcacaactacagatttccaggaaagaccatgtataaggataatttcactatcaagaag
gttagtgggtacaggcataccatcctttgtcaaaatctttgtttgtttgccaagttattc
ttggacagtaagtcagtctatttttccatagaaaactttgatttctacgtggtacttggg
gagtctaatggacgtcgagtgccaatgggctttttcagcaaagagttattgtcctgggat
gagaacaatttagcttgcatattgatctttccccctttccaaagaaagcgtttgggacac
ttattgatagagttttcatacgaactgtctaggttcgaaggaaaggttagcggacctgag
ttcccgctatcagcatttggaaagatagggtatctaaaatactggtccaaagtcatctgc
agggaattgctatatggccgttttagtgactgtcaatccatcaccttgcaaaagttatca
aagttcacatgcataagagttaaagatttgatatcaacattagattatatgggatcgtgg
tttaccacatctgacatcgagaactctaaatctcttgatcagtatccactggcaatatca
aggagtgttctcaaacaatggataaagggagaaagttctaattgtcaaaagttgattcaa
gaggacagcttggtgttgtactaa

DBGET integrated database retrieval system