KEGG   Komagataella pastoris: PAS_chr3_0361Help
Entry
PAS_chr3_0361     CDS       T01092                                 

Definition
Nicotinamidase
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
ppa  Komagataella pastoris
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PAS_chr3_0361
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PAS_chr3_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:707000..707659
Genome map
AA seq 219 aa AA seqDB search
MSKSALLIIDLQNDFLEGGSLAVPDGNEIIDPIIELAQKKDWDLVIATKDWHPQDHTSFA
SNHGVKPYTELEFTNPENEAEKKIQVVWPDHCVQNSNGSEFPPKFKAFWEQFTGPKELVK
KGYLSDREYYSAFSDVWKLHKTELDSLLKGHGIRNVTIVGLALDFCVFHTASDALRENYS
VTLVTNLTRSVADREGPPSKLQSLGAHLAEYNGSEIIIK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatcggcactacttattattgatttacagaacgactttctagaaggggggtca
ttggctgttcctgacggaaatgagatcatcgatccaatcattgagctagctcagaagaag
gattgggatttagtcattgccactaaggattggcatccccaggaccatacgtcatttgcc
tctaaccacggagtcaagccgtataccgagctagagttcacaaacccagaaaatgaagcg
gaaaagaaaattcaggtggtgtggccggatcattgtgttcaaaactccaatggaagtgaa
tttccacctaagttcaaggccttttgggaacagtttacagggcctaaagagctagtgaag
aaggggtatctttccgatagggagtactattctgcatttagtgacgtttggaagctgcac
aaaaccgaactggattcgcttttgaaagggcatggtattcgaaatgttacaattgtaggt
cttgctcttgatttctgcgtatttcacactgccagtgatgctctccgagagaactattcg
gtaacattggtgactaacctcaccaggagtgttgccgatcgcgaaggtccgccctccaag
ctacaatccctgggagcacatctcgcagagtacaacggcagcgaaattattatcaaatag

DBGET integrated database retrieval system