KEGG   Komagataella phaffii: PAS_chr3_0361Help
Entry
PAS_chr3_0361     CDS       T01092                                 

Definition
(RefSeq) Nicotinamidase
  KO
K01440  nicotinamidase [EC:3.5.1.19]
Organism
ppa  Komagataella phaffii
Pathway
ppa00760  Nicotinate and nicotinamide metabolism
ppa01100  Metabolic pathways
ppa04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PAS_chr3_0361
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    PAS_chr3_0361
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PAS_chr3_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-GeneID: 8199494
NCBI-ProteinID: XP_002492582
UniProt: C4R4B7
Position
3:707000..707659
Genome map
AA seq 219 aa AA seqDB search
MSKSALLIIDLQNDFLEGGSLAVPDGNEIIDPIIELAQKKDWDLVIATKDWHPQDHTSFA
SNHGVKPYTELEFTNPENEAEKKIQVVWPDHCVQNSNGSEFPPKFKAFWEQFTGPKELVK
KGYLSDREYYSAFSDVWKLHKTELDSLLKGHGIRNVTIVGLALDFCVFHTASDALRENYS
VTLVTNLTRSVADREGPPSKLQSLGAHLAEYNGSEIIIK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatcggcactacttattattgatttacagaacgactttctagaaggggggtca
ttggctgttcctgacggaaatgagatcatcgatccaatcattgagctagctcagaagaag
gattgggatttagtcattgccactaaggattggcatccccaggaccatacgtcatttgcc
tctaaccacggagtcaagccgtataccgagctagagttcacaaacccagaaaatgaagcg
gaaaagaaaattcaggtggtgtggccggatcattgtgttcaaaactccaatggaagtgaa
tttccacctaagttcaaggccttttgggaacagtttacagggcctaaagagctagtgaag
aaggggtatctttccgatagggagtactattctgcatttagtgacgtttggaagctgcac
aaaaccgaactggattcgcttttgaaagggcatggtattcgaaatgttacaattgtaggt
cttgctcttgatttctgcgtatttcacactgccagtgatgctctccgagagaactattcg
gtaacattggtgactaacctcaccaggagtgttgccgatcgcgaaggtccgccctccaag
ctacaatccctgggagcacatctcgcagagtacaacggcagcgaaattattatcaaatag

DBGET integrated database retrieval system