KEGG   Komagataella pastoris: PAS_chr3_0399Help
Entry
PAS_chr3_0399     CDS       T01092                                 

Definition
Minor sphingoid long-chain base kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ppa  Komagataella pastoris
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PAS_chr3_0399
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     PAS_chr3_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(779590..781059)
Genome map
AA seq 489 aa AA seqDB search
MSDKPLLQTLSRAIITQSGIQLSGNWHESNYHPLFCCSGSSSDSSIHRTIPYHDILFAEE
LDSSASDGDFGTREIELTYVARNNKIDLKKEIVIVTDYEPNLSQTILQKAYGQTDRTHPQ
RILVLINPHGGKGKALRLFEDKAEPILNAAQCEYEVCTTLKHQHATELIRTRKDILDFDT
IVCASGDGIPHEVINGLYQRDDRAECFEHLTVTQIPCGSGNAMSLSCLDTNDPAEAALSV
LKAPSVRIDLMAITQPSQSVRLSFLSLTYGMIADGDIGTEWLRFLGPFRFEVGIVTKLLQ
NAKYPCDLSVDFCAKDHQLLSQHYCDNIKSDYSKTQHLPITDQSFELKSPSLENPPPTDW
ERLDSQITDNLSIFYVGKMPIVSADTNFFPAAIPDDGCMDLVITDNRSSVLDTANLLLQV
DKGTHVLQKDVIHSKVKAFRLTPRIPKGYISVDGESFPFETTQVEVLPTLLKTVMKEGTY
AETGFPSYS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataaaccattacttcagactctctcaagagctattataacccagagtggaata
cagctatcgggtaattggcatgaatcaaattaccaccctcttttttgttgcagtggctcc
agttcagacagttcaatacatcgtacgattccttatcatgacattctattcgccgaagag
cttgattcttcagcatctgatggcgactttggtaccagggaaattgaactgacatatgtc
gcaagaaacaacaaaatagatttaaaaaaagagatagtcatcgttactgattacgaaccc
aaccttagtcaaaccatcctacagaaagcatatggtcagactgaccgaacgcatccacag
agaatacttgtcttaataaatccgcatggaggtaagggaaaggcgttgcgattatttgaa
gacaaagctgaaccaattctgaacgcagcacaatgcgaatatgaagtgtgtacaacgttg
aagcaccaacatgctacagagctgatcagaacgaggaaggacattttagattttgacact
attgtctgcgcttctggagatggaataccgcatgaagttataaacggactctaccaaagg
gatgaccgtgcagaatgttttgagcacttgacggtcactcaaattccctgcggatcagga
aatgccatgtccttgagttgtttggacacaaacgatcccgcagaagcagctttaagcgtc
ctgaaagcaccaagcgttcgtatagatttgatggccataacccagccttctcaatctgtg
aggctttcgtttttgagtctcacttatgggatgattgcagacggagatattggaaccgaa
tggctgaggtttttgggtccatttcgattcgaagtcggtatagtgacgaagttgttacaa
aatgccaagtatccatgtgatctgagtgtggatttctgtgctaaagatcatcagttgtta
tctcaacactattgtgacaacattaaatcagattattccaaaacgcagcaccttccaatt
acagatcagagttttgaactcaagagcccttcactcgagaatcctccacccacggactgg
gaacgtttagacagtcaaattaccgacaacctatcgatattttacgttggtaaaatgcct
atagtttcagctgacacaaatttctttccagcagctattccagatgacggatgcatggat
ttagtaataaccgacaatcgctcaagtgttttagatactgcgaatctgctactccaagtc
gataaaggtacacatgttcttcagaaggatgtgatacattcaaaggtaaaggctttccgt
cttacgccaaggatacccaagggatatatatccgtagatggggagagctttccctttgaa
actactcaggtggaagttcttccaacactacttaaaacagtcatgaaagagggaacatac
gcagaaacagggtttccaagttactcgtga

DBGET integrated database retrieval system