KEGG   Pichia pastoris: PAS_chr3_0459Help
Entry
PAS_chr3_0459     CDS       T01092                                 

Definition
Dual-specificity kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ppa  Pichia pastoris
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PAS_chr3_0459
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PAS_chr3_0459
Protein kinases [BR:ppa01001]
 Serine/threonine protein kinases: Other group
  TTK family
   PAS_chr3_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(886269..887993)
Genome map
AA seq 574 aa AA seqDB search
MKSLSGLGLSPDSNRSEEILPPELNVVTMSMLDDVSFKPTLKPRRERTSVYKDPSIFDKY
SNEYFTPHTQTRAPITPPSQQCMESLGRGSSRLSKKYNRIGLGAPKRLSQKLTDEFSLEN
IMQRGTKTQQRRQQLDQKLQDKDLDPDNLQEIQKDLESHRSKYLNELKRQNHSPPLTTTK
AQLPDVAPYFDRNTPAQKTPSREPLRPISSNVRCQELNTATTTNKTSVQPQAPQDNIQRS
KPIVQINNKHYEKLELIGRGGSSKVYKVKSFANNKAYAIKRVTLDQFDSNAIKGFKGEIQ
LLQKLSNSDRVVKLIDYNFSDTTIHLVMELGEIDLAHVLTSQNSLDLNAVRFYASELFKC
VQAVHQSGIVHSDLKPANFLFVRGVMKIIDFGIANALDDVTCNIYRDSQIGTPNYMAPEA
LIECSSKGVASLGPESSTWKIGKGSDIWSCGCILYQMVYGRPPYAHFNGNQRLMAIMNPQ
VQIEYSEKGLDDVRVPSALKSLMQGCLERDLTKRITCEEALNSNFLNPKTVSREFICDLV
DHALKYGARNQNVTPDVMSSLCEEVWSKVCQSNN
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcactttctgggctagggctctctcctgactcaaatcggagtgaggagattttg
cctccagaacttaatgtggtcacaatgtcaatgttggatgatgtcagcttcaagccaact
ttgaagcctaggcgggagagaacttcagtgtacaaggacccttccatatttgacaaatac
tccaacgagtatttcacacctcatacacaaaccagggctcccattacgccaccgtcacag
caatgtatggagtcattgggaagagggtcttctcgtttgtcaaaaaaatacaatcgaata
ggtttaggagctcctaagcgactgtcgcagaaactaaccgatgagttttcactggaaaat
attatgcaaaggggtacaaagactcagcaaaggaggcagcaattggaccaaaagttgcaa
gataaagatttggacccggataacttacaggaaattcaaaaggatcttgaatcccatcgc
tcaaagtacctcaacgaactgaagaggcaaaatcatagtcctccattaactacaacaaaa
gctcaattgccagatgtagcgccatactttgatagaaatacaccggcgcagaagactcca
tccagagaacctttacgtccaatttctagcaatgtacgatgccaagaattaaacacagca
acaacaaccaacaaaacctctgtgcaaccccaagcgccacaagataacatacaacgatca
aagcccattgttcaaataaataataaacattatgaaaagcttgaattgattggtagagga
ggttcgtcaaaggtctacaaagtcaagtcttttgcaaataataaggcctacgctataaag
cgagtcacattggatcagttcgacagcaatgccatcaaaggattcaaaggcgaaatccag
ctgttacaaaaacttagtaactctgatagagttgttaagttgatcgattacaatttctct
gacacaacgatacacctagtaatggaactgggagaaattgacctagcacatgtgttgacg
tcgcaaaacagtttagatctcaacgcggttcggttttatgcttcagaactatttaaatgt
gtgcaggcagtgcatcaatcgggtattgtacatagtgacctcaagcctgcaaactttttg
tttgttcgtggtgtgatgaagattatcgattttggaatagcaaatgccttggatgatgtg
acatgcaatatttatagagattctcagattggaacgcccaactatatggctccagaggct
cttatagaatgcagttccaaaggtgttgcatccctgggtcccgagtctagtacttggaaa
attggaaagggatctgacatatggtcttgcggctgtatcttgtatcaaatggtttacgga
agacctccttatgcgcactttaatgggaatcagcgattaatggcaatcatgaatcctcaa
gtacaaattgaatattcagaaaaagggctagatgatgtcagagtaccatccgctttgaaa
tcattaatgcaaggatgcttagaaagagatcttactaaaagaattacctgtgaagaagcc
cttaacagcaactttttgaaccccaagacagtttccagagagttcatttgtgacttagta
gaccatgccttgaagtatggcgcaagaaaccagaatgtcacaccagacgtgatgagctct
ttgtgcgaagaggtgtggagcaaagtctgtcagagcaataactga

DBGET integrated database retrieval system