KEGG   Pichia pastoris: PAS_chr3_0575Help
Entry
PAS_chr3_0575     CDS       T01092                                 

Definition
Cyclin associated with protein kinase Kin28p
Orthology
K06634  
cyclin H
Organism
ppa  Pichia pastoris
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ppa03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ppa03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1094053..1095063)
Genome map
AA seq 336 aa AA seqDB search
MTSSDSTNQEETPQPEKHSKQITNDDLYRRSTQFRFWSFTEQRLKDLKRSTNEKGAANLK
ERISQLDPSIPEVSEIWEKDLVKPLTVEEEVKIVEYYARKAQGLANYFKLPTQSRATAIS
FFRKFFLVNSCIQFHPQYIMYTCLFLAAKSDNHFIGIKEFSKAIPKTTPESILQYEFQIL
QSLKFALLCHHPYKPLYGFFLDFQVEMKNNIQSDKLAELYDHARDKVSEALFSDVSFLFT
PSQIALAAYYELNPELVTSYLSKKFSQLSTINEDEQLKPSPNIQTKLVDNLKHCIELSHA
SFDPEIEEVTQISRKVHYCIDPMKLVKKMQKQKAVS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgtctgattcaaccaaccaggaggaaactccgcaaccagagaaacattcaaag
caaattactaacgatgatctctaccgaaggtcgacccagttcagattttggtcatttacc
gagcaacgattgaaggatttgaagcggtcaactaatgaaaagggagctgccaacttgaaa
gaaagaatatcacaattggatccttctataccagaagtctctgagatttgggaaaaggac
ctcgtgaaaccgctcactgtggaagaggaggttaaaattgtcgaatattatgcgaggaaa
gcccaaggccttgccaattatttcaaattaccaacacaatcaagggctactgccatatca
ttttttagaaagttctttctggtcaacagctgtatacaatttcacccacaatatatcatg
tacacatgcctgtttctagcagctaaatcagacaaccactttattggaataaaggaattt
agcaaggccattccaaaaacaaccccagagtcaattttacagtacgaatttcagatactg
caaagcttgaagtttgctcttttatgccatcacccttacaaaccattgtatggattcttt
ttggattttcaagtggaaatgaagaataatatccagtcagataaactcgctgagttgtat
gaccacgcaagagataaggtatctgaagcattattttctgatgtttcatttttgtttact
ccttcacaaatagcgttggctgcctattatgagctgaatcctgaacttgttacgagttac
ctttccaaaaagttttcccaattaagcaccatcaacgaagatgagcagttgaagccttct
cccaacatccaaaccaaacttgtagataacctgaaacattgcatagaactatctcacgca
tctttcgatccagaaatagaagaagttacccagatttcaagaaaagttcactattgcata
gatcctatgaagctggtcaagaagatgcagaagcagaaagcggtgtcatag

DBGET integrated database retrieval system