KEGG   Komagataella pastoris: PAS_chr3_0575Help
Entry
PAS_chr3_0575     CDS       T01092                                 

Definition
Cyclin associated with protein kinase Kin28p
Orthology
K06634  
cyclin H
Organism
ppa  Komagataella pastoris
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PAS_chr3_0575
  Replication and repair
   03420 Nucleotide excision repair
    PAS_chr3_0575
Transcription machinery [BR:ppa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PAS_chr3_0575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1094053..1095063)
Genome map
AA seq 336 aa AA seqDB search
MTSSDSTNQEETPQPEKHSKQITNDDLYRRSTQFRFWSFTEQRLKDLKRSTNEKGAANLK
ERISQLDPSIPEVSEIWEKDLVKPLTVEEEVKIVEYYARKAQGLANYFKLPTQSRATAIS
FFRKFFLVNSCIQFHPQYIMYTCLFLAAKSDNHFIGIKEFSKAIPKTTPESILQYEFQIL
QSLKFALLCHHPYKPLYGFFLDFQVEMKNNIQSDKLAELYDHARDKVSEALFSDVSFLFT
PSQIALAAYYELNPELVTSYLSKKFSQLSTINEDEQLKPSPNIQTKLVDNLKHCIELSHA
SFDPEIEEVTQISRKVHYCIDPMKLVKKMQKQKAVS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgtctgattcaaccaaccaggaggaaactccgcaaccagagaaacattcaaag
caaattactaacgatgatctctaccgaaggtcgacccagttcagattttggtcatttacc
gagcaacgattgaaggatttgaagcggtcaactaatgaaaagggagctgccaacttgaaa
gaaagaatatcacaattggatccttctataccagaagtctctgagatttgggaaaaggac
ctcgtgaaaccgctcactgtggaagaggaggttaaaattgtcgaatattatgcgaggaaa
gcccaaggccttgccaattatttcaaattaccaacacaatcaagggctactgccatatca
ttttttagaaagttctttctggtcaacagctgtatacaatttcacccacaatatatcatg
tacacatgcctgtttctagcagctaaatcagacaaccactttattggaataaaggaattt
agcaaggccattccaaaaacaaccccagagtcaattttacagtacgaatttcagatactg
caaagcttgaagtttgctcttttatgccatcacccttacaaaccattgtatggattcttt
ttggattttcaagtggaaatgaagaataatatccagtcagataaactcgctgagttgtat
gaccacgcaagagataaggtatctgaagcattattttctgatgtttcatttttgtttact
ccttcacaaatagcgttggctgcctattatgagctgaatcctgaacttgttacgagttac
ctttccaaaaagttttcccaattaagcaccatcaacgaagatgagcagttgaagccttct
cccaacatccaaaccaaacttgtagataacctgaaacattgcatagaactatctcacgca
tctttcgatccagaaatagaagaagttacccagatttcaagaaaagttcactattgcata
gatcctatgaagctggtcaagaagatgcagaagcagaaagcggtgtcatag

DBGET integrated database retrieval system