KEGG   Komagataella pastoris: PAS_chr3_0604Help
Entry
PAS_chr3_0604     CDS       T01092                                 

Definition
Putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppa  Komagataella pastoris
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAS_chr3_0604
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PAS_chr3_0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1139601..1140626
Genome map
AA seq 341 aa AA seqDB search
MSNSITIIGSLNYDMVTYTYVLPEAGQTVLSNHFECHYGGKGLNQAISAGKLLAPDSQTI
VRMVGKIGNDSFGKELKQYLEDNRVSASHVSTEKDVCTGIATIIVEQESGENRILCTPGA
NGKLILTDNELETVFEDEKDRDYPGFVILQNEQPDPVSCISWIKSHRPNLIITYNPSPFN
EEILLDKRIWSCVNVLVVNEGEALTCVKQLNSFSVSEIKDKINSNLVHGYTILAKELNRV
LNPESGYSLVVITLGSQGSVYATDIESQYIPSLQVEPSKIVDTTGAGDTFLGALVVKLAQ
KEPIEEAIRFATAASSLTVQRRGAAESIPQYEDVISLLESH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattccatcacaattataggttcgctgaactacgatatggttacatacacttac
gttttgccagaggctggacagactgtgttgtcaaatcactttgagtgtcactacggagga
aaaggactcaaccaagccatatcagcgggaaagcttttggcgccagattctcagacaatt
gtgagaatggtaggcaaaattggcaatgatagtttcggtaaagaactgaagcagtaccta
gaggataatagagtgtccgccagtcatgtttcaaccgagaaggatgtatgtactggaatt
gccacgattattgttgagcaggagtctggagaaaatagaattctttgcactccaggagcc
aatggaaaactaattcttactgacaatgagcttgaaaccgtttttgaagacgaaaaagac
cgagactatcctggttttgttattcttcaaaatgagcaacccgatcctgttagctgtatc
agctggataaaaagtcataggccaaacctcatcattacttacaacccgtccccattcaac
gaggagattttgctggacaaaaggatttggagttgtgtgaacgttcttgttgttaacgag
ggtgaagccctgacttgtgtaaaacaattgaactcgttttccgtcagcgagatcaaggat
aagatcaactcaaatttagtacatggatacacaattcttgcaaaagaattaaacagagta
ttgaacccagaatcgggatatagtttagttgtgataactcttggatcccaaggctcagtg
tacgcaaccgatattgagagccagtacatcccttccctccaagttgaaccttccaagatc
gtagacaccacaggtgctggagatactttcctcggagcgttggtagtgaaattggcacag
aaagaaccaattgaggaggctataagatttgctaccgcagcatcatctttgaccgttcag
agacggggagcggctgaatcgattccccaatatgaagacgtgatatcgttgttggaaagt
cattga

DBGET integrated database retrieval system