KEGG   Komagataella pastoris: PAS_chr3_0605Help
Entry
PAS_chr3_0605     CDS       T01092                                 

Definition
Ubiquitin carboxyl-terminal hydrolase
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
ppa  Komagataella pastoris
Brite
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PAS_chr3_0605
Peptidases [BR:ppa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAS_chr3_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(join(1140738..1140745,1140796..1144228))
Genome map
AA seq 1146 aa AA seqDB search
MSTGVSQERNIDETDSDLNSGAQKSQYESIILQRQVVQKMLDTYTMKEGDVFCLVPKDWY
QRFFTFTYDPTDNEIFLKIGIINIAELLDANGLVKKPDGEDFVEYEILPYTVFQQLVSWY
GLFSGLQPIQRIVIARKDGELELEVYPCYFRLHLMDNERNSLDINNFILSRYSTIRDLKY
HATERFNTEFYHSRLWLVDDPNISNLPLTITVSSFEKIKFKKLLVEKIEDFDKTLEEAGL
NSCHLVVEYKLKKDSEWPSDITCKPAKLSTGLVGLTNLGNTCYMNSALQCLMHIPELSNY
FLYDFYKEEINVDNPLGNGGRLAIAFGSLIHTTLGPKKQIVTYATPKDFKLTLGRFNSMF
LGYHQQDSQELLAFLLDGLHEDLNRILKKPYLDKPELKDHLVQDKEAVRQLAEDCWSQHK
MRNDSIITDLFVGLYKSTLVCPVCQKISITFDPFNDLTLPLPVDKKWYHQIIFFPETGYP
KALDVELDKSSTFDHLKNYVSSKLQVPINDLIGADIFNSQFYKNFEANDPDLNYLPISDL
ISSGDKTVFYQVKHKPGDLVVPVFNTLSDDGGRYAKPFGLPFLITISEDESFSFGSIRDK
LERKYDQLSTLNYFDQIKQESKEIHKLADFPTLNKKYQNDSPNEDNSLSDVDCTSDISFA
NPKISGDFAFNIKLFDSSREFKPRYNLGARHIDIDENEDDSLWLPQTNNSFGNLPILLDK
LCEKKRAFYTYKKFEAEEELADEDDSESVNVNVEEVDENDNNLDTQQDESNDESMMGGMF
EESKNSAPVSPPCSEVATNTESNAFEPLIKTRQALVCEWEQDSFGKFFVGLGDDDDKSGT
QTWETPEVIPNEELIQNKKLIEEKLNKNIALQECLDIFSKPELLGENDLWYCPNCKDHRQ
ATKTIEIWKTPDILTIHLKRFENQRSFSDKIDAVVDFPIEALDMSEYVVNPETGDEIYDL
FAVDNHFGGLGGGHYTSYVKNHIDHKWYYFDDARVSAAEPEQAIKGSAYLLFYRRRSSTP
LGGEYLRQMMTQVREQEEVHREMENEILRDYVKLKEMQDAITAYEEKCQQVQVSEAVEST
LDEQQLECDSDRELENAGNVEADAESSQSINQVEKDQNEPSSMVSSANGAKRRKKQQNNL
LMSRLC
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgggtgtctcacaggagagaaatattgatgagacagactcggatcttaattcc
ggagctcaaaaatctcaatatgaaagtataatattgcaacgtcaagttgtgcagaagatg
ttggacacttacacgatgaaagaaggtgacgttttttgcttagtgcctaaagattggtat
caaaggtttttcacgttcacttatgatccaaccgacaacgaaatctttctcaaaattggg
atcattaatattgccgaattgctagatgctaatgggttagtaaagaagcctgacggcgaa
gattttgtggagtatgagatcctcccttacacagtctttcaacagttggtctcttggtac
gggttgttctctggtcttcaaccaattcagaggatagtgatagcccgtaaagacggagag
ttggaattagaagtgtatccttgctatttccgtttgcatttgatggataacgagcgcaac
tccctggacatcaacaacttcatcctatcaagatactccactatacgtgatctcaaatat
catgccacagaaagattcaacaccgagttctatcactctcgtttgtggttggtagacgat
cctaatatctccaatctacccttgacaattacggtgtcctcctttgagaagatcaaattc
aaaaagctactagtagagaaaatagaagactttgacaagactttagaagaagccggactg
aacagttgtcatcttgttgtggaatataagctgaagaaagattcagaatggccgtccgac
ataacctgtaaacctgcaaaattgagtaccggtttagtggggttaaccaatttgggtaac
acatgttatatgaattcagcacttcaatgtttgatgcatatacctgaactttcgaattat
tttctctatgatttttacaaagaggagatcaacgtcgataacccattgggtaacggaggg
cgcttggcaattgcatttggaagcttgattcatacaaccctaggtccaaagaagcaaatt
gttacctatgcaactcctaaggacttcaagctcacgctgggtcggttcaactcaatgttt
ttaggctatcatcagcaagattctcaagaactgctcgcattccttctcgatggattacac
gaagatctgaacagaattttaaagaaaccttatttggataagccagaattgaaagaccac
ctagtccaagataaagaagctgtccgacaacttgctgaagactgctggagtcaacacaaa
atgagaaatgactccataattacagacttattcgttggattatacaaatccactttggta
tgtccagtatgccaaaaaattagtattacatttgacccattcaatgatctcacactacct
cttcctgtagataagaagtggtatcatcaaattatattttttccagagacaggttacccc
aaggcgttggatgttgaactggataagtcatctactttcgatcatctgaaaaattacgtt
tcatccaagctgcaagtcccaatcaacgacctaattggtgctgatatatttaacagtcaa
ttttataagaactttgaggccaatgatccagatctgaattatcttccaatcagtgactta
atctcttcaggtgataagacagtattttatcaagtaaagcataagccaggagacttggtg
gttccagtctttaacactctttctgatgatggtggccgctatgcaaagccttttggcctt
ccatttcttatcacaatttccgaggatgaatcattttcctttggatctatcagagacaaa
ttggagagaaaatatgaccagttatcaacgcttaattacttcgaccaaatcaagcaggag
agtaaggaaatacacaagctcgctgattttcccacgttaaacaagaaataccaaaatgat
tcacccaacgaggataactctttatccgatgttgattgcacttcggacatatcgtttgcc
aatcctaagatctctggagattttgcttttaatatcaaactgttcgattcaagcagggag
ttcaaaccaaggtataaccttggtgccaggcacattgatatagatgagaatgaagacgat
agcttgtggcttccacaaaccaataacagctttggcaacctacctattttgcttgacaaa
ttgtgtgaaaagaaaagagctttttacacgtataaaaaatttgaggctgaggaagaactt
gcagatgaagatgactcggaaagtgttaatgtcaacgttgaagaggtcgacgaaaacgac
aacaacttagatacgcaacaagacgagtccaatgatgaatctatgatgggcggtatgttt
gaagagtcaaaaaattcagctcccgtttcacctccctgttctgaggttgctactaataca
gagtcaaatgcttttgagcctttgataaaaacaaggcaagccttagtctgcgagtgggag
caagattcctttggcaagttttttgttggtttaggagatgatgacgataaaagtggtact
caaacttgggaaactccggaagtaattccaaacgaagaacttattcaaaataagaagcta
attgaagagaaattgaacaagaacatagccttacaagaatgtttagacatattttccaaa
ccagaattattaggcgaaaacgatctatggtattgtccaaattgtaaagatcacaggcaa
gccaccaagactattgaaatctggaaaacaccagatatcctaacgatccacctcaagaga
tttgaaaatcagcgtagctttagtgataaaattgacgctgtagtggatttccccattgaa
gcattggatatgtcagaatatgtggtgaacccagagactggtgatgaaatttatgattta
tttgctgttgataatcattttgggggattgggaggtggccactacacttcatacgttaag
aatcatattgaccataaatggtactattttgatgatgcgagagtatcagctgcagaacct
gagcaggctattaaaggatcagcatatctattgttttacagaagaaggtcttcaactcca
ttaggaggggaataccttcgtcagatgatgacacaagtgagagaacaggaagaggttcat
agagaaatggagaatgaaatccttagagattatgtcaaattaaaagaaatgcaggatgct
ataaccgcttatgaagagaaatgtcaacaagtgcaggttagcgaggcagttgagagtact
ctggatgaacaacaactggaatgtgattccgatagagaattagaaaatgctggcaacgtt
gaggcagacgcagaatctagtcagtcgatcaatcaggtagagaaagaccaaaatgagccc
tcatcaatggtatcttcagcaaatggggctaaaaggaggaagaaacaacaaaacaatttg
ttaatgagtcgtctatgctga

DBGET integrated database retrieval system