KEGG   Komagataella pastoris: PAS_chr3_0693Help
Entry
PAS_chr3_0693     CDS       T01092                                 

Definition
Tetrameric phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppa  Komagataella pastoris
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAS_chr3_0693
   01230 Biosynthesis of amino acids
    PAS_chr3_0693
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAS_chr3_0693
  Energy metabolism
   00680 Methane metabolism
    PAS_chr3_0693
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAS_chr3_0693
Enzymes [BR:ppa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PAS_chr3_0693
Exosome [BR:ppa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PAS_chr3_0693
  Exosomal proteins of melanoma cells
   PAS_chr3_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1318176..1318928
Genome map
AA seq 250 aa AA seqDB search
MTEAKYTIILVRHGQSQWNRLDRFCGWEDVHLSTEGARQAEYSGRLIRESGIIPTVLHTS
RLTRSCQTGNIILEQLNRQYIDIYRSWRLNERHYGALQGRFKSDVLKEVGKEKYMEWRRA
YEGCPPLLEEADHDDRYRNVDRSELPRGESLKMVLERFLPYVNDVLVPLLEKDPSEIPLL
SVHGSIVRALIKYWYSISDEDISGINIPNAIPLVITLDKDFKPVGAYKYLDPQSAYVEAN
KVAHQGFGQT
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggccaaatacacgataatactagttcgtcacggccaatctcaatggaatcgg
ttggacaggttctgtggatgggaagatgtccacttgtccactgaaggtgctcgtcaagct
gagtactctggtagattgatcagggaatctggtataatcccaacagttctgcatacttca
agattgaccaggtcttgtcaaacaggaaacattattctagagcaattgaatcgccaatac
attgatatttataggtcttggagactgaacgaaagacattatggagcgctgcaaggtcgc
ttcaagtccgatgttttgaaagaagtaggcaaagaaaagtacatggaatggcgtcgagct
tacgaaggatgccctcctttgctagaagaagccgatcatgatgaccgatacaggaacgtg
gaccgatctgaacttccccgaggcgagtctttaaaaatggttctggaacgatttttaccc
tacgtaaacgacgtattagtacctcttttggaaaaggatccttctgagatacctcttctt
tccgttcatggatccattgtgcgtgctcttatcaagtattggtacagcatatccgatgag
gatatttcgggtatcaatattcccaacgcgataccactggtgattacactggataaggac
ttcaagccagttggagcatacaaatatttagatccgcagtcagcctacgttgaggctaac
aaggtggcacaccagggattcggacagacttaa

DBGET integrated database retrieval system