KEGG   Pichia pastoris: PAS_chr3_0701Help
Entry
PAS_chr3_0701     CDS       T01092                                 

Definition
Subunit of the core complex of translation initiation factor 3(eIF3), essential for translation
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ppa  Pichia pastoris
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PAS_chr3_0701
Translation factors [BR:ppa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PAS_chr3_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1334353..1336500
Genome map
AA seq 715 aa AA seqDB search
MTNEPEIDISSIDFSDLEKKYTVEDDGSYMNKFIIVDGAPIAPESKVPILTKVLKKLFSA
VGELQDDSIHMPLEDGKTKGYLFIGYKTAEGANEAVKKLHGKKLDQQHRLLVNKFSDMDE
YLTDFNDEFKEPATYKLPSTKVLDSWLLDEQARDQFSLEMGNIAGIYWYKHGFPPTPVVE
PRVNWTELFTKFSPKGSYFLSVHKLGIHAWGGEDFKSIHKFYHPGVRLIDFSPDERYLVT
LSPEPITLPAKNHPARASFPFKQEDVGNKLVIWDFQTGLPCRTFALPPDLEKEKKMTWPL
VKWSYDSKYCARKGPGAIAVYEAPSFQLVNKKLLNAPGVAEFEWAPAGVRTETQKKGEEP
EHLLAYWSPEQINLPAKVAVVQVPTNSIVRTVNLTNVTDCKLYWHDNGSYLCCKVDRHTR
SKKTIFSYLEFFKVTKKDIPVIKLELKEAVTTFAWEPTSERFGIITTDDVQGTTPNKMNV
SFYAPEISKGKVNTETVWRPFRTIGGKNSNAIVFSPKGRFVVAATLNAGSGDLDFYDLDF
EGERNENDTKFKVKASFKQLAHHGYHGITHLQWEDSGRFVAGWSSVWKHTSDNGFKIYNF
AGILQIEDQVEAFKKFSWRARPKSILTEEDKKKVEENLEQYSAQFEELDSMEADANLREI
IMRRKKLLKEWKEYRDFVEAHLKELGLYEEEKKEDVEVIEEVREEILEEKEEIVD
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgaaccagaaatcgatatcagtagcatcgacttctccgatttggaaaagaaa
tacaccgttgaggatgatggttcttacatgaacaagttcattattgtcgacggggcacct
attgcccctgaatcgaaagtccctatcttaaccaaagtgctgaagaagttattcagtgct
gttggtgaactgcaagatgattccatacacatgcctttggaggacggaaagactaaaggg
tatctctttattggatataagacagcagagggtgccaatgaggctgtcaagaagttgcac
ggaaaaaaattagaccaacagcacaggttgttggtcaataagttttctgacatggacgag
tacttaaccgatttcaacgatgaattcaaagagcctgccacctacaaactcccaagcacc
aaagtcttggactcttggttattagatgaacaagcaagagatcaattttctttggaaatg
ggcaacattgctggtatttattggtacaagcatggatttcctccaactcctgtcgttgag
ccaagggtcaactggactgaacttttcacaaagttttctcccaaaggttcttacttttta
tctgttcacaagctaggtatccatgcttggggaggagaggacttcaagtctattcacaag
ttctaccacccaggcgttaggttgattgatttctctcccgatgaaagatacttggttact
ttgtcaccagagccgattacactccctgctaaaaaccaccctgcacgcgcttccttccct
ttcaaacaggaagatgttggaaacaagctggttatctgggatttccaaaccggtcttcct
tgtagaacatttgctttgcctcctgacctggaaaaggagaaaaaaatgacctggcctttg
gttaagtggtcatatgattctaaatattgtgcaagaaaaggtccaggtgcgattgctgta
tatgaggctccatcattccaattggtaaacaagaagcttctcaatgctcccggtgtcgct
gagtttgagtgggcccctgcaggtgttagaacagaaactcaaaagaagggcgaagaacca
gaacatctcttggcgtactggtcgcctgagcaaattaacttgcccgctaaggttgctgtc
gttcaagtgcctactaattcaatcgtgcgaactgttaacttaactaacgtgacagactgt
aaactatactggcatgataacggttcttacttgtgctgtaaggtcgaccgtcatactaga
tccaagaaaaccattttctcgtacctggagttcttcaaggttaccaagaaagacattcct
gtcatcaaattagaattgaaggaagctgtaacaacttttgcttgggagcccaccagtgaa
aggtttggtatcatcacaactgatgacgttcaaggtaccactcctaacaagatgaatgtt
agtttctatgctcctgaaatttccaagggtaaagtcaacacggagactgtatggaggcct
ttccgaactattggggggaagaatagtaatgctattgtgttctctcctaagggtcgtttt
gttgttgctgcaactttgaatgcaggctctggagaccttgacttttatgatctcgacttt
gaaggagagcgcaatgagaatgacaccaagttcaaggtgaaggcttctttcaaacaacta
gctcatcacggatatcacggaatcacccatcttcaatgggaggattctggccgtttcgtt
gccggatggtcttccgtatggaaacatacaagtgacaacggttttaaaatctacaacttt
gctggtatccttcagatcgaggaccaagttgaggcattcaagaaattctcatggagagca
aggcctaaatctattttgacagaggaggacaagaagaaagtggaagagaacttggaacaa
tatagcgcacaatttgaggagctggattctatggaagccgatgctaatttgagagagatc
attatgagaagaaagaagctgctcaaagaatggaaagagtacagagatttcgtagaagct
catctaaaggagctgggactgtacgaagaggagaagaaggaagatgttgaggtgatcgag
gaagtaagggaggagattctggaagagaaagaagaaattgtggattag

DBGET integrated database retrieval system