KEGG   Pichia pastoris: PAS_chr3_0781Help
Entry
PAS_chr3_0781     CDS       T01092                                 

Definition
Glycogen synthase, similar to Gsy1p
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ppa  Pichia pastoris
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAS_chr3_0781
Enzymes [BR:ppa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PAS_chr3_0781
Glycosyltransferases [BR:ppa01003]
 Polysaccharide
  Storage polysaccharide
   PAS_chr3_0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1497578..1499689)
Genome map
AA seq 703 aa AA seqDB search
MGKDITNHLLFEIATEVANRVGGIYSVLKSKAPVTVAEYKDRYTLIGPLNANSANVEVEE
LPVLDPVLKRTLDSMSGRGIRYLYGRWLIEGAPRVILFDIGSAAGYLNEWKSDLWNIAGV
PTPEHDVETNDAILLGYLVAWFLGELVHNDGHKRAIICHAHEWLAAVCLPLCRKRKIDVT
TVFTTHATLLGRYLCAGSVDFYNNLDKFDVDAEAGKRGIYHRYCIERAAAHSADVFTTVS
HITAYEAEHLLKRKPDGVLPNGLNVIKFQAVHEFQNLHAEKKEKINEFIRGHFYGQLDFK
LNNTLYFFIAGRYEYRNKGVDFFIESLARLNHRLKASNSNMTVVAFIIMPAKTNSYTVET
LKGQAVIKQLENTINDIEALVGKRLFEFCQHPATSSNSSHIEMPDIDDLLKPSDRVLLKR
RMFAMKREGLPPIVTHNMADDSTDPILNQIRNVQLFNRPEDRVKIIFHPEFLNSNNPILS
LDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCYMEDLIENSSDYGI
YIVDRRLKSVDESIDQLTSYMFDFVDKTRRQRINQRNRVERLSDLLDWRRMGLEYVKGRS
LALRRAYPDEFKNQNNEHSNPFSESNSIKITRPLSVPGSPRDKYSSSANIMTPGDLGTLQ
ENNSTDYISWRLGNDTEEDGLDVTLRGLSVAPSAEQSGDEFDA
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagatatcactaaccacctgttgtttgaaattgcaaccgaagtggccaatcgg
gttggaggaatttactccgtcctgaagtccaaggctccggtgaccgtcgctgaatataag
gatagatacactctaattggccctctcaatgccaacagtgctaacgttgaagtggaagag
ctacctgtattggatccagttctgaagagaactctggactcaatgtctgggagaggcatt
cgttatctctacggtagatggttgattgaaggagccccaagagtaattcttttcgatatt
ggtagcgccgcaggttatttgaatgagtggaaatccgacctgtggaacatcgctggcgtc
cccactccagagcatgatgtcgagacaaacgatgctattcttctgggatacctagtcgct
tggtttttgggagagttggttcacaatgatggccacaagagagcaattatttgtcatgcc
catgaatggctggccgctgtctgtttgcctctttgccgcaaaagaaaaatcgatgtaacc
actgtctttactacgcacgctaccttactgggcaggtacctgtgtgctggttccgttgac
ttctacaacaatctagacaagtttgatgtggatgctgaagctggaaagagaggtatctac
caccggtactgtatcgagagagctgccgcacatagtgccgatgtgttcactacagtgtca
cacatcacggcctacgaggcagaacacctgctcaagcgtaagcctgacggtgtgcttcca
aatggtttgaatgttatcaagttccaagctgttcacgagttccaaaacttgcatgctgag
aaaaaagagaagattaatgagttcattcgtggtcacttctacggacaattggactttaaa
ctcaacaacaccctttatttctttattgctggtagatacgagtatcgtaataaaggtgtc
gatttcttcattgaatcattggcaagacttaatcacaggcttaaggcatccaattctaac
atgactgtggttgcctttattatcatgcctgcaaagacaaactcttacacagtggagact
cttaagggccaagccgttatcaaacagttggaaaacactatcaacgatattgaagctttg
gtcggaaaacggctgtttgagttctgtcaacatccagctacttctagcaactcctctcat
attgaaatgcctgatatcgacgacttgctcaagccatctgatagagtcctgctcaaacgt
cgaatgttcgccatgaaaagggagggattaccacctatcgtcacacacaacatggctgac
gatagtactgatcctattctcaaccagattagaaatgttcagctgttcaacagaccagag
gaccgggtcaaaatcatttttcatcctgaattcttaaactctaacaacccaattctgagt
ttggactacgatgagtttgttagagggtgtcatttgggagtgtttccatcctattatgaa
ccttggggttacactccagcagagtgcacagttatgggtattccttcaatcaccactaat
ttatccggattcggctgctacatggaggacttgatagaaaactcttcagattatggtatt
tacattgtggacagaagattaaaatctgtcgatgagagtattgaccaattgacttcttac
atgttcgatttcgtcgacaagaccagaagacaacgtatcaaccagagaaacagagttgag
cgtctgtctgatctcttagactggcgtcgtatgggattggaatacgttaagggtcgttca
ttggctcttcgcagagcttaccctgacgagttcaagaaccagaacaatgagcactctaac
ccattcagcgaatccaacagtatcaaaatcactcgaccattgtccgtaccaggttcacca
agagataagtactccagcagtgccaacatcatgactcctggagaccttggtacacttcaa
gagaacaattccacagactatatctcgtggagattaggaaatgatactgaagaagatgga
ctagatgtaacgcttcgtggactcagtgtcgccccaagtgccgagcaaagtggtgacgaa
tttgatgcctga

DBGET integrated database retrieval system