KEGG   Komagataella phaffii: PAS_chr3_0826Help
Entry
PAS_chr3_0826     CDS       T01092                                 

Definition
(RefSeq) Tetrameric phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppa  Komagataella phaffii
Pathway
ppa00010  Glycolysis / Gluconeogenesis
ppa00260  Glycine, serine and threonine metabolism
ppa00680  Methane metabolism
ppa01100  Metabolic pathways
ppa01110  Biosynthesis of secondary metabolites
ppa01130  Biosynthesis of antibiotics
ppa01200  Carbon metabolism
ppa01230  Biosynthesis of amino acids
Module
ppa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ppa_M00002  Glycolysis, core module involving three-carbon compounds
ppa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAS_chr3_0826
  Energy metabolism
   00680 Methane metabolism
    PAS_chr3_0826
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAS_chr3_0826
Enzymes [BR:ppa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PAS_chr3_0826
Membrane trafficking [BR:ppa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PAS_chr3_0826
Exosome [BR:ppa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PAS_chr3_0826
  Exosomal proteins of melanoma cells
   PAS_chr3_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Tnp_22_dsRBD
Motif
Other DBs
NCBI-GeneID: 8200319
NCBI-ProteinID: XP_002493059
UniProt: C4R5P4
Position
3:1599170..1599916
Genome map
AA seq 248 aa AA seqDB search
MVKLILVRHGQSDWNEKNLFTGWVDVRLSPTGEKEAARAGELLKEKNIHPDILYTSKLSR
AIQTANIALDKADRLSIPVVRSWRLNERHYGALQGKDKAETLEKYGAEKFQTWRRSFDIP
PPEIEDDSEFSQANDERYNDVDPNVLPKTESLALVIDRLLPYWQDTIAKSLLEGKDVMIA
AHGNSLRALVKHLDKISDADIAGLNIPTGIPLVYELDERLNKTKEAYYLDPKAAEEGAKK
VAAQGQKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggttaagttaattttggtgcgtcacggtcagagtgactggaatgaaaagaacctcttc
accggatgggtcgatgtcagattgtctccaactggagagaaggaggcagccagagccggt
gaattgttgaaggagaagaacattcaccctgacattctgtacacatccaagctgagcaga
gccatccaaaccgccaacatcgctttggacaaggccgacagattgtccattcccgtcgtg
agatcctggagattgaacgagagacactacggtgctcttcaaggaaaggacaaggctgag
accttggagaagtacggagctgagaagttccagacctggagacgttcttttgacattcct
ccacctgagattgaggatgattctgagttctcccaagccaacgatgagagatacaacgac
gttgatccaaacgttttgccaaagactgagtcattggcccttgtcattgacagattgttg
ccatactggcaagataccattgccaagtctcttctggagggtaaggacgtcatgatcgct
gcccacggtaactcccttagagctttggttaagcatttggacaagatttctgatgctgat
attgctggtttgaacatcccaaccggtattccattggtctacgagttggacgagcgtttg
aacaagaccaaggaagcttactacttggatccaaaggctgctgaggagggagccaagaag
gttgctgctcaaggccaaaagaaatag

DBGET integrated database retrieval system