KEGG   Komagataella pastoris: PAS_chr3_0853Help
Entry
PAS_chr3_0853     CDS       T01092                                 

Definition
Ubiquitin C-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ppa  Komagataella pastoris
Brite
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PAS_chr3_0853
Peptidases [BR:ppa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PAS_chr3_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1659314..1659988
Genome map
AA seq 224 aa AA seqDB search
MSSAVIPLESNPEIFSSFGTQLGLLPRYAFYDIFSLDAEMLSLYPRPNDGVILLFPVTKE
YEEFKAKETPSEDVNIHWYKQKVKNACGLYALLHILTNASKDHLQQDRSNILDRYEKNQE
SIDLLIQDVSKHIYNQYAVQGETEAPSAEEDITLHFITFVKNSDGKLIELDGRRDGPIDL
GTLDESSMDILDSQLLKNRIETYMGLVDEENRNNFALMGLGPID
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgccgtcattcctttggagtctaatcctgagatattttccagttttggtacg
caactgggtttactcccccgatacgctttctatgacatattctctctagatgctgaaatg
ctcagtttataccctcgtccaaatgatggcgtaattctgttgttccccgtaaccaaagag
tacgaagagttcaaggccaaggaaactccttctgaagacgtgaatatacattggtataag
cagaaggtcaagaatgcctgtggattgtatgcgctattgcatattctgactaatgcttcc
aaagaccatttacagcaagatcgaagtaacattctagaccgttacgaaaagaaccaggaa
agtattgacctactcattcaggatgtctctaaacatatatacaaccagtacgccgtgcag
ggagaaaccgaagcaccgtcagctgaagaggatatcacccttcatttcataacttttgtg
aaaaatagtgatggcaagttgattgaattggatggacgtcgagatggacctatcgatctc
gggactttggatgagagcagcatggatattcttgatagtcaattgttgaaaaatcgtatt
gagacgtatatgggactggtggatgaagaaaacagaaacaactttgctctcatgggactg
gggcctattgattaa

DBGET integrated database retrieval system