KEGG   Pichia pastoris: PAS_chr3_0895Help
Entry
PAS_chr3_0895     CDS       T01092                                 

Definition
Serine/threonine MAP kinase
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ppa  Pichia pastoris
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PAS_chr3_0895
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PAS_chr3_0895
Protein kinases [BR:ppa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PAS_chr3_0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1742705..1743985
Genome map
AA seq 426 aa AA seqDB search
MSGDHKSFTVFNQEFIIDRDFELIKALGQGAYGVVCSAQYKGNEDGGKVAIKKVTNIFSK
KILAKRALREIKLLRHFRGHKYITCLYDLDVIPDQNNNFNEIYLYEELMECDLHHIIKSK
QPLTDSHYQSFIYQILGGLKYIHSADVLHRDLKPVNLLVNSDCELKICDFGLARGYSSDA
EKNAGFLTEYVATRWYRAPEIILSFQTYTKAIDIWSVGCILAELLGGRPIFRGRDYVDQL
NLILSTLGTVSEETLQSIRSERAQDYVRSLPFMPKIPFSQLFPGANPEAIDLLDRMLTVD
PTHRITVTEALEHPYLKVWHDPNDEPVCSSKFDFSFEVVDDIETMKQMIVDEVLSLREFV
RRPIQEQQLPFTEPDKHFDVSFDQPQIEPPAENYRDDHLPRPHELESQILDLEHELQYGL
DRYGTQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtgaccataagagctttacggtttttaaccaggagtttatcattgaccgagac
tttgaattgatcaaggccttggggcaaggtgcatatggagtggtgtgcagtgcacagtat
aagggtaacgaagatggaggaaaagtggccatcaaaaaggtgaccaacattttcagcaaa
aagatcctagccaagagggctttaagagagatcaaactgctgcgccatttccgaggccac
aagtatatcacttgcctgtatgacttggatgtcattccggaccaaaataataatttcaac
gagatctacctttacgaagaattgatggaatgtgacttgcatcatataatcaaatcaaaa
caacctttgactgacagccactatcagagctttatctaccaaattctcgggggcttaaag
tatatccattcagcagatgtgctgcatagagatcttaaacccgtcaatctattggtgaac
tcagattgcgaacttaagatttgtgactttggacttgcaagaggttatagtagtgatgca
gagaagaatgctggctttcttacggaatatgttgctaccaggtggtatcgggcaccggag
ataattcttagttttcagacatataccaaagcaattgatatctggtcagttggatgtata
ttggccgaactcttaggtggccgacccatttttagaggaagagactatgtggatcaattg
aacttgattttgagtacgctgggtactgtttcggaagagacacttcagtctatcagatca
gagcgtgcccaggattatgttcgctccctgccattcatgcccaagatcccattcagccag
ttatttcccggtgccaaccctgaagcgatagacttactggatcgaatgctcacggtagat
cccactcacagaattacagttactgaggctttagagcatccatatctcaaggtttggcat
gatcctaacgatgagcccgtctgttcttccaaattcgatttctcgtttgaggtcgtggac
gatatagaaacgatgaagcaaatgattgtagatgaagtgctatcacttagagaatttgtc
agacgaccaattcaagagcagcagttaccattcactgaacctgacaaacattttgatgtt
agctttgaccaaccgcaaatcgagccccccgctgaaaactatagagatgatcatcttcct
agacctcatgaattagagtcccaaattttggatctagaacatgaattacaatacggattg
gatcggtatggtacacagtaa

DBGET integrated database retrieval system