KEGG   Komagataella pastoris: PAS_chr3_0933Help
Entry
PAS_chr3_0933     CDS       T01092                                 

Definition
Ubiquitin-specific protease that specifically disassembles unanchored ubiquitin chains
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ppa  Komagataella pastoris
Brite
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PAS_chr3_0933
Peptidases [BR:ppa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAS_chr3_0933
Exosome [BR:ppa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PAS_chr3_0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1824332..1826722)
Genome map
AA seq 796 aa AA seqDB search
MACTHFNSADNIKAPTKGTPVFKDDCMLCFDTAFEPKGLDICLHCFQSFSRGDLNHTQLH
SALFDHTLYLNLKKVLKPKRERKEGEESPEKIAKLEIKDQSEEDLFNIQTALFCSSCDDQ
FPLKQEDLPASTNSIVETVLHSSSNERKEEIKSWEQEILPCHHCFDIVQQPIEDLDLTQC
QSCDLKENLWICVVCGSLGCGRQQFGGIPGNSHALSHFESHENHNIAVKLGSLSSDSADC
YCYNCNDEVKVPELGKYLSRFGINIHEVVKTEKNLTELQIEQNVKWDFNMDQKDGKSLVP
VFGRELTGFKNLGNSCYLASVLQTLFSLRSYKEFFLNRDFPIDRLTTPNTDLNIQLIKIA
DGLLSGRYSIPDYSTTEEIKFQRGIKPFGFKNLIGQNHPEFSTMKQQDAYEFWLYIMDKI
DELYVSEENPPNSPLHFVLENKLKCSTCSSVRFIKEVTNSLALPVEDTVLDIDDDGRERY
QPVTFESCFKNWAQEEEIEHKCSFCQGEKLVKSQSLQTFPDVLTVSTERIKLKNWVPIKT
DVPILFKRAEEKTLERIDLSNLRSQGLLEGESLMPEDVSDSEETGFEPNPEAIQQLEAMG
FPNNRCLKALFNTGNLSAEDAMNWLFSHMEDPDIDSPFELPKDSSSSKPAIEPSQELVDN
LVSMGFTSKLAKKALILNNINIEAAVEWLFSNPDDDGEIPDGPPKAKSQEQQISELIVKE
SIKRPEYKLLAVICHKGITVHSGHYVVFIKKKIDGQPRWILFNDEKVVLADEANIKEMES
NGYLYIFAKVGSKDDL
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcacacactttaatagtgctgacaacattaaagctccgacaaagggcactccg
gtatttaaagatgactgcatgctgtgttttgatacagcgttcgaaccgaaaggtctcgat
atttgcttgcattgctttcaatcattttccagaggcgatctgaaccatactcaactccat
tccgctctatttgatcacactttgtacttaaatttgaagaaagttctcaaacccaaaaga
gaaagaaaagagggcgaagaaagtccagaaaagattgccaaattagaaatcaaagatcaa
tcggaagaagatttatttaacattcaaactgcccttttttgctcttcgtgtgatgatcag
tttcccttaaagcaggaagatcttccagctagtactaattcaatagttgaaactgtcttg
cattcaagctccaatgaaaggaaagaagagatcaagtcttgggaacaagaaattctgccc
tgccatcattgttttgacatcgttcagcaacctatagaagatttagaccttacccaatgt
caatcatgcgacttgaaggagaacttgtggatatgtgttgtttgtggtagtctaggatgc
ggaaggcaacagtttggaggtattccgggaaattcccatgcgttgtctcactttgaaagt
catgaaaaccataatatcgctgtaaagctaggctctctatcctcagattctgcagactgt
tattgttataattgtaatgatgaagttaaagtgcctgaacttggcaagtacctatcaaga
tttggtatcaatattcatgaagtggtaaaaactgagaagaacctcactgaacttcaaatt
gagcagaatgtcaaatgggactttaacatggatcaaaaagatgggaagtcattggttcct
gttttcggtcgagaattgactgggttcaagaacttgggaaactcctgttatctcgcaagt
gttttgcaaacattgttctcccttcggtcgtacaaagaattttttctcaatagagatttc
ccaattgatcgattgactactcctaatactgatttaaacatacagcttataaaaatagcg
gatggacttctttcgggaagatattccatccctgattattcaacgactgaggaaataaag
tttcaacgtgggataaagccttttggattcaagaatttaattggtcagaatcatccagaa
ttttctaccatgaagcaacaagatgcttatgaattttggctttatatcatggacaagatt
gacgaattgtatgtgtctgaagagaatcctcctaactcgccgctccattttgtgctggag
aacaaattgaaatgttctacttgttctagtgtcaggtttataaaggaggtcacaaacagt
ttagccctccccgtggaagacacagtgttggatattgatgatgatggtagagaaagatat
caacctgtaacctttgagtcttgtttcaaaaattgggctcaggaagaagaaatcgaacac
aaatgttcattttgtcaaggggaaaaacttgtcaaaagtcagtcattgcaaacgttccct
gatgttttgacggtgtcaacagagaggatcaagttgaagaattgggtaccaatcaagacc
gacgttccaatcttgttcaaaagagcggaagaaaaaactttggaaaggatcgatctctca
aacctgagatcacaaggcttacttgaaggagaatcgttaatgcccgaagatgtttccgat
tccgaagaaaccggatttgaacccaacccagaagctatccaacaacttgaagcgatgggc
tttccaaataatcgatgtttgaaggctttatttaatactggcaacttgtctgctgaagat
gctatgaattggctctttagtcatatggaagatcctgatattgactctccatttgagttg
cctaaagatagcagcagcagcaaacccgcaattgaaccaagccaagaattggtagataat
cttgtttctatgggctttacgtcaaaattggcaaagaaagccctgatacttaataatatc
aacatagaagctgcggttgagtggttattttcgaatcccgatgatgatggagagattcca
gatgggccacccaaagcaaagtcgcaagaacagcagatcagcgagcttattgtgaaagaa
tccataaagagacctgagtacaaattattggctgttatatgccataaaggaatcactgtt
cattctggccattacgtggtgtttatcaagaagaagatcgatggacaaccaaggtggatt
ttgttcaatgacgaaaaggtggtgttggcagatgaagccaacatcaaggagatggagtcc
aatgggtatctttacatttttgcgaaagtgggaagtaaagacgatttatga

DBGET integrated database retrieval system