KEGG   Pichia pastoris: PAS_chr3_0937Help
Entry
PAS_chr3_0937     CDS       T01092                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase, member of a family of enoyl-CoA hydratase/isomerases
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ppa  Pichia pastoris
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAS_chr3_0937
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PAS_chr3_0937
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAS_chr3_0937
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAS_chr3_0937
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PAS_chr3_0937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1833532..1835046)
Genome map
AA seq 504 aa AA seqDB search
MFAQSKPPSIAIAKRRLFQLNSILRMSTDVRFHVDNKARVISLNRSAKLNALSTDMCHQI
VPRLLEYSKSDSNNLIVLRSDEPRAFCSGGDVVQCAKDNLAGQIARSVEFFTAEYNLNYL
LATFNKPIVSLVNGIVMGGGVGLSVHGPFRVVCETTRFAMPETNIGFFPDVGTSFWLSRL
DGNLGYYLALTGDELHGFDSLIAGFGTHYVPSHRFDALLQRLANIEQFKEDKSPKEFYSM
VDQAIEDFVEPIPQDYKFKFSPEELNTIEAAFDPKANPSVESVISALEADGSDFALKIVE
TLQSKSPISLKVAYELLQRSAKSKIYEAISNELVLANNMMTGVEPNDFNERILKNLINRK
STNPEDKIIKPAFKTLQDIPDEVVDNLLKGSAASTLAKPSSSLKEGEDGSSEADVLANAR
INQFFGVNYDQYPYNHGLPTQLEIENYVTGNDNSNRQYSVTRDEVLKYFDIKYKDKLGVS
FKVQNVLDRKTKSSDYGEQYLQWI
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctcaatcaaagcctccaagcatcgccatagctaagaggcgtctgtttcaattg
aactcaatccttagaatgtcaactgatgtccgctttcatgtcgacaataaagctcgagtg
atctctcttaacagatcagccaaactcaatgctctctccacagacatgtgccatcaaata
gttcccagattattagaatattccaaatctgactccaacaatctgattgtgctacgttca
gatgaacctagggcattttgttctggtggtgatgtggtccagtgtgccaaagataacctg
gcaggccagatcgcccgttcagttgaattcttcaccgctgagtacaacctcaactatctc
ctggcaaccttcaacaaaccgattgtctctttggtgaatggtattgttatgggaggtggt
gttggactatcggttcacggacccttcagagttgtttgtgaaaccactcgttttgccatg
cccgaaaccaacatagggttttttcctgacgtcggaacttctttctggttgtcccgtcta
gacggtaatttaggctactatttggcgctgactggtgacgaattgcatggttttgattcc
ttgatcgctggatttggtactcattacgtcccctctcaccgttttgatgcgttgttgcaa
cgtctggccaacatagagcagttcaaagaagacaaatctccaaaggaattttacagcatg
gtcgaccaagctattgaagattttgttgaaccaattcctcaagattacaagttcaaattt
tctccagaagaactcaataccatcgaagctgcattcgaccctaaggccaacccttccgtt
gaatctgtgatcagtgctttggaagccgacggttcagattttgctttgaagattgtcgag
actcttcaatcgaaatcgccaatctccttgaaggttgcatatgaacttctacaaagatct
gcaaaatctaaaatttacgaagctatttccaacgaactggttctagcaaacaacatgatg
accggagttgaacctaacgacttcaatgagcgtatcctcaagaacctgatcaatagaaag
tctactaatccagaggacaagatcatcaaacctgctttcaagactttgcaggatatccca
gatgaggtagtcgataacctgctgaagggtagcgctgcatctaccttggctaaaccatct
tcttctttgaaggagggagaagacggcagctccgaggccgacgttctcgccaatgctagg
attaatcagttctttggtgttaactacgaccagtatccttacaaccacggacttcctacg
caattggaaattgagaactatgttactggtaatgacaactccaatagacagtacagtgtt
accagagacgaggtattgaagtacttcgacatcaagtacaaggacaagctgggagtcagc
ttcaaagtgcagaacgttctagaccgcaagaccaagagttccgattatggagaacaatac
ctccaatggatctaa

DBGET integrated database retrieval system