KEGG   Pichia pastoris: PAS_chr3_0962Help
Entry
PAS_chr3_0962     CDS       T01092                                 

Definition
Bifunctional enzyme exhibiting indole-3-glycerol-phosphate synthase and anthranilate synthase activi
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
ppa  Pichia pastoris
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAS_chr3_0962
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAS_chr3_0962
Enzymes [BR:ppa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PAS_chr3_0962
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     PAS_chr3_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1865691..1867151
Genome map
AA seq 486 aa AA seqDB search
MTKRVLLIDNYDSFTWNLYQYLCQEGAHVDVYRNDEITLEQVSQLNPDVVVISPGPGHPT
TDSGISVDVIKTFKGKIPIFGVCMGQQCMIAAFGGVVEYAGEIVHGKTSPIAHDGKGLFQ
HIPDGVVVTRYHSLAAESKSLPPVLEVTAKTDNGIIMGIRHKEYVIEGVQFHPESILTEE
GHRMVRNMLEYSTGLWETSTSKTEQAKIPEPKKSILDEIFAKRIQDVEAQKKVPGKSLEH
LQKYIDWGLAPKQIDFYQRLQSTISQGKSAILAEIKRASPSKGDIDINANAAEQAVKYAT
AGCAAISVLTEPTWFKGNIDDLRYARIAMEGIPNRPALLRKEFIFDPYQILEAKLAGADT
VLLIVKMLSDETLKSLYNFSLSLGMEPLVEVNNETELKRALKIGSKIIGVNNRNLHDFGV
DLNTTSQISTLIIEDDGVILIALSGIFGTKETLHYRSQNVKAFLIGEALMRSKDASSFVK
ELVETV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacgagtccttttgattgataactacgattccttcacttggaacttgtaccag
tatctgtgccaggagggtgcccatgttgatgtgtataggaatgacgagattacattggag
caagtctctcaactgaatcccgatgttgtcgtcatctccccaggccctggtcatccaaca
actgatagtggaatttcagtagacgtcatcaagacattcaagggtaagatacctatattt
ggtgtctgcatgggccagcaatgtatgattgcagctttcggaggtgtggtagagtacgct
ggcgagattgttcatgggaagaccagccctatcgctcatgacggcaaagggctgttccaa
catattccggacggagtggttgtgacgagatatcactcacttgctgcagagtccaaaagt
ttacctccagtactagaggtcactgccaaaactgataatggcattattatgggcataagg
cacaaagaatatgtcattgaaggtgtacaatttcacccagaaagtattttgactgaagag
ggtcacaggatggtaagaaacatgctggaatactcgacaggtctttgggaaacaagcacc
tcaaaaactgagcaggctaaaatacctgaacccaagaagtctatattggatgagatattc
gcaaaacgaattcaagatgtggaggctcagaagaaggtgcctggtaaaagtttggagcat
ttgcaaaaatacattgattggggacttgcacccaaacagattgatttctatcaaagattg
caatccactatttcacaaggcaagtctgcaattttagcggagatcaagagagcgtcccct
tctaagggagatattgatattaacgctaatgcagcagaacaggctgtcaagtatgccact
gctggatgtgctgccattagtgtgctgactgaacccacctggtttaaaggaaatattgac
gacttacgatatgctcgcattgccatggaaggcatacccaacagaccggcacttttgcga
aaggagtttatatttgatccctatcaaatactggaagccaagctagccggggcagacact
gtccttttgattgtgaaaatgctaagtgatgagactttgaagtctttgtataatttttcc
ctaagccttggaatggaacccttggtagaagtgaacaatgaaactgagttgaaaagagca
ttgaaaattggaagcaagattattggggtgaacaatagaaacttgcacgattttggagtt
gacttgaacacaacttcacagatatccacattgattattgaagacgatggtgtgattctt
atagccctaagtggaatctttggaaccaaggagacacttcactatcgatcgcagaatgtt
aaggcatttttaataggagaggccctaatgagaagcaaagacgcttctagttttgtgaag
gaactggttgaaacagtctag

DBGET integrated database retrieval system