KEGG   Pichia pastoris: PAS_chr3_0964Help
Entry
PAS_chr3_0964     CDS       T01092                                 

Definition
cAMP-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ppa  Pichia pastoris
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ppa04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1868429..1869766)
Genome map
AA seq 445 aa AA seqDB search
MDYNQVHLNTIQQLNEPQKSNTPPAQSHMIGMPIVPVYPTEYPSDSMQHSPPDSTSRFQH
LLVHHRNEDPQTQKYIQEHHIRQLLRLEKEEQQQKELQQQQQEQEQTEQGESESTEQPSI
RVTKDKYNINDFRLVRTLGTGSFGRVHLVRSVHNGRYYAMKVLRKRQVAKAKQIEHTNDE
RKILAMVQHPFITRMWGTFQDSKSIFLVMEYIEGGELFSLLRKSKTFPNQVAKFYAAEAF
LALEYLHSHNIIYRDLKPENILLTKSGHIKLTDFGFAKEVKLKTYTLCGTPDYIAPEVIA
VQPYNRAADWWSFGILIYEMLSGTTPFYDQSPMKTYENITRCELRFPPGDSFFQADSRDL
LTKLITKDVTYRLGNLQNGSYDIKSHAWFQEVVWENLLNGNIETPYEPNIPSGVGDSSQF
DHYPEDEYDYGVQGKDEFGYLFPDF
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggactataatcaggtacacttgaacaccatacagcagctcaacgagccgcaaaaatct
aatacgccccctgcccaatcacatatgatcggcatgcctattgttccagtataccctact
gagtatccatcagactcaatgcaacactcgccaccagatagcacttcgagatttcaacat
ttacttgtgcatcatcgtaatgaagatcctcagacacagaagtatatacaggagcatcac
atacggcaattgcttcgtcttgaaaaggaggagcagcagcaaaaagaactacagcaacag
caacaggaacaggaacaaacagaacagggcgaaagcgaatccacagagcagccatcgatt
agagtaaccaaggacaagtataacattaatgatttcaggctggtacgcaccctgggaacg
ggctctttcggaagggtgcatttggttcgatccgtccataatgggcgttactacgcgatg
aaggtattgcgtaagcgtcaagtagccaaagccaaacaaatagaacataccaacgatgaa
cgaaagattcttgcaatggttcaacaccccttcattacacgtatgtggggcacatttcag
gactctaagagcatattcctggtgatggaatatattgagggtggggaacttttttcactc
cttaggaaatccaaaaccttcccaaaccaagtcgccaagttttatgcagctgaagcattt
cttgcattggagtatttgcattcacataatatcatttatcgagatcttaaaccagagaac
attttgttaaccaaatcaggacacatcaaactaacagatttcgggtttgctaaagaagtc
aaactgaaaacttatactctttgcggaactccagattacatcgcccctgaagttattgca
gtgcaaccatacaacagagctgctgattggtggtcgtttggaatcctcatatacgagatg
ttgagtggaactactcccttttacgaccagtcacctatgaagacgtatgagaacatcact
agatgcgaattgcgatttcctcccggtgattcttttttccaagcggattcacgggacctt
cttactaaacttattactaaggatgtgacgtatagactagggaaccttcaaaatggatca
tatgacatcaaatcccatgcttggttccaagaagttgtatgggagaacctcttgaatgga
aatatagagactccatatgagccgaacattccatcaggagtgggtgacagttctcaattt
gaccattatccagaagacgaatacgattacggtgttcagggtaaagatgagtttggatat
ctatttccggacttttag

DBGET integrated database retrieval system