KEGG   Pichia pastoris: PAS_chr3_0972Help
Entry
PAS_chr3_0972     CDS       T01092                                 

Definition
Cytoplasmic mRNA cap binding protein
Orthology
K03259  
translation initiation factor 4E
Organism
ppa  Pichia pastoris
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PAS_chr3_0972
Translation factors [BR:ppa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PAS_chr3_0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1886742..1887350
Genome map
AA seq 202 aa AA seqDB search
MSETENAPHEKSLLDDQVDFTVKHPLNSEWTLWYTKPAVHEQESWSDLLRPIISFNSVEE
FWGIFNSIPKASDLPVKSDYHLFRDGIKPEWEDERNANGGKLTYQFAYRKVDINELWSRG
LLSVIGETIQDDDGETEVNGIVLSIRRAALKIALWTKSKDEAVLRPIGERFKKVLKLTAR
DHIDFQPHKSGAGSKNVPSFSI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagactgaaaacgctcctcacgaaaagtcactgcttgacgaccaagttgatttc
actgttaagcatccgctcaactctgagtggacactatggtatacgaagccagccgttcat
gaacaagaaagttggtcagatttgctacgtcctatcatttcattcaactcggtagaggag
ttctggggaatcttcaactccattccaaaggcctccgatttgccagtcaagtcggactat
catctttttagagatggaatcaaacctgaatgggaagacgagcgcaatgctaacggagga
aaactgacataccagtttgcctacagaaaggttgatatcaatgaattgtggtctcgcggt
ctgttgagtgtgattggtgaaacgattcaggatgatgacggagaaactgaggtgaacggt
attgttctgagcattcgtcgtgccgctttgaagattgccctctggaccaagtccaaggat
gaggcagttttgagaccaattggcgagagattcaagaaagttttgaagttgacagcccgt
gatcatattgactttcaacctcataagagtggtgctggtagcaagaacgtaccttctttc
agcatttag

DBGET integrated database retrieval system