KEGG   Pichia pastoris: PAS_chr3_1022Help
Entry
PAS_chr3_1022     CDS       T01092                                 

Definition
Dual function protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ppa  Pichia pastoris
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ppa03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1963587..1964357)
Genome map
AA seq 256 aa AA seqDB search
MSWDDEDFDIPSKVPAQSWEDEVDDEPLLESWDTVDTPKAPVKTSTKTVSKKKENKANPT
QKKLDIDLVDDKTRRELLKQAELDADLNNAADLFDGLGVADEHPRARAARAALEANGGVG
KAALTKDTPLREHPIFELETKQDYVNLRKALSTQLTSYAKDSMLNYSSSLAIDLIRDLSN
PLSLENLRKVISTLSVMEKEKIKVERQARLAKSGGTSTGGAGKKKAKNVRANVGGSFRKD
DMDTTNYDDLGDDDFM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggacgacgaagattttgatatccctagtaaagttcccgcccagagttgggag
gatgaagttgatgatgaaccattattagaatcttgggatacagtagacacacccaaagcg
cccgtcaagacctccaccaagactgtttcaaaaaagaaggagaataaggctaaccccacc
cagaaaaagttggatattgaccttgttgatgacaaaacacgtagggaactgttgaagcaa
gcggagttggacgctgatttgaacaatgctgcagatctctttgacggattaggtgttgct
gatgagcaccccagggcaagagcagcccgtgcagcccttgaggccaacggtggtgttgga
aaagcagctctcaccaaagatactccattgagggagcatccgatatttgaactagagacc
aagcaggactatgtgaacctccgtaaggcactctccacacaactaacatcttacgctaaa
gatagcatgttgaattattcttcatctttagcaattgatcttataagagatttgagtaac
cctctatcgttggagaacctcagaaaggtcatatccactttgagcgtaatggagaaagag
aaaatcaaggttgagcgccaggcacgtttggctaaaagtggtggaacttccacaggaggt
gcaggaaaaaagaaggccaaaaacgtgcgtgctaatgttggaggctcgttcagaaaggat
gatatggataccactaattatgatgatcttggtgatgacgatttcatgtag

DBGET integrated database retrieval system