KEGG   Komagataella pastoris: PAS_chr3_1126Help
Entry
PAS_chr3_1126     CDS       T01092                                 

Definition
6-phosphogluconolactonase, catalyzes the second step of the pentose phosphate pathway
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
ppa  Komagataella pastoris
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAS_chr3_1126
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAS_chr3_1126
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     PAS_chr3_1126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:2170764..2171513
Genome map
AA seq 249 aa AA seqDB search
MVQIYSYERSDEIANAVANYILDIQDHVLKTNTVFRIAVSGGSLGKVLKKGLIDNQENRS
KIAWDKWHVYFSDERLVKLNHEDSNYALFNEMVLKPLQKFKMPLPRVVTIKEDLLDESRI
NDAMIASEYEHHLPSVLDLVLLGCGPDGHTCSLFPNHKLLRETSKRIAAISDSPKPPSRR
ITFTFPVLENSSNIAFVAEGEGKSPVLRQIFGEEKTNLPCEIVNKLSTRVSWFVDNHALS
GVSVSTSKY
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaatctattcctatgaacgatctgatgaaattgctaatgcagtagccaattac
atattagacattcaggatcacgtactaaaaactaatactgtttttaggatcgctgtcagt
ggaggctcccttggcaaggtattaaagaagggattgatagacaatcaagagaacagatca
aaaattgcctgggataaatggcatgtgtatttcagtgacgaaaggttagtaaaactcaat
cacgaggactccaattatgccctattcaatgaaatggttttgaagcctctacaaaaattc
aaaatgccactaccaagagttgtcaccatcaaggaggatctattagatgaaagccgaata
aacgatgcaatgatagcaagtgagtatgaacatcaccttcccagtgttttggatcttgtc
cttttgggatgtggacctgatggtcatacttgttccctttttccgaaccacaaactatta
agggaaacctcaaaacgcattgctgctatatcagattctcccaagccaccttcgaggaga
ataactttcacatttccagtccttgagaactcctctaatatagcttttgtcgccgaagga
gaaggaaaatctcctgtcttaaggcaaatttttggagaagaaaagaccaatttaccatgc
gaaatcgtaaacaaattatctactcgagtgagttggtttgtcgataaccatgctcttagt
ggagtctccgtttctacttcgaaatactga

DBGET integrated database retrieval system