KEGG   Pichia pastoris: PAS_chr3_1128Help
Entry
PAS_chr3_1128     CDS       T01092                                 

Definition
Histone acetyltransferase, acetylates N-terminal lysines on histones H2B and H3
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAS_chr3_1128
Transcription machinery [BR:ppa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PAS_chr3_1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:2175189..2176535
Genome map
AA seq 448 aa AA seqDB search
MTSDTNRRGINNEKRQESSNKRTKYNATQNEHVVESPMKIEVSQDFQMNEDTNAELKNVD
DAEEVKDCKVSERNSNDEENKYITEFDFYGEKYTFKERPAVIEEKEGKIEFRVVNNDNTK
ESIMVLTGLKNIFQKQLPKMPREYISRLVYDRSHLSIAIIKKPLTVVGGITYKPFNQREF
AEIVFCAISSTEQVRGYGAHLMNHLKDYVKATSNIKHFLTYADNYAIGYFKKQGFSKEIS
LDKRVWMGYIKDYEGGTLMQCSILPKIRYLDSSKILLLQKAAILKKIRSISKSNIVHPGL
KQFKSANVIKAVDPMQIPGLKEAGWVREMDELAQLPKRGPHHAFMANLITELQNQPSSWP
FLQSVNREEVPDYYEVIKEPMDLSTMETKLENDHYHTLEDFIYDATLIFNNCRSYNNEST
TYYKNANKLEKFMKSKIREVPEYADMVD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgacacgaataggagaggcatcaataatgaaaagagacaagaatcatccaac
aaaaggaccaaatataatgcaactcaaaacgagcatgtcgtcgagtctcctatgaaaata
gaagttagtcaagactttcaaatgaatgaggatacaaatgcagaattgaaaaatgttgat
gatgcagaagaagttaaagactgtaaggtgtctgaaaggaattcgaacgatgaagaaaat
aaatatatcacagagtttgacttttacggagaaaaatacacgttcaaagaaagaccagca
gttattgaggaaaaggagggtaaaattgaatttagagtagtaaacaacgataacaccaag
gaaagtattatggttctgactgggttgaaaaacatttttcagaaacagcttcctaaaatg
ccaagagaatatatatctcgcctggtgtatgatcgaagtcatttatcgattgcaattatc
aagaagcctttaactgtagttggggggatcacttataaacctttcaatcagagggaattt
gcagaaattgtgttttgcgccattagttctactgaacaagtccgcggttacggagcacac
ctaatgaatcatctaaaagactacgttaaagcaacaagcaacatcaaacattttttaaca
tacgcagacaactatgctattggctatttcaaaaagcagggatttagtaaggagatatca
cttgacaaaagggtttggatggggtatatcaaggattatgaaggtggcactttgatgcaa
tgttctattctacctaaaattcgatacctagattcttctaaaatcttgctcttacagaaa
gcggccatattgaagaaaatcagatctatatccaaatctaatattgttcatccgggcctg
aaacagttcaagtctgcaaatgtgattaaggctgtcgacccaatgcaaattcctggatta
aaggaggcagggtgggtccgggaaatggacgagttggctcaattgcccaaaagaggtccc
catcatgcattcatggctaatctcataaccgaactacaaaatcagccttcctcgtggcca
tttctgcaatcggtgaatcgtgaggaagtacctgattactacgaagtgatcaaagagcct
atggacctctctacaatggagacgaagcttgaaaatgatcattaccatacactagaagat
ttcatctatgatgcgacattgatattcaacaattgtagatcgtacaacaatgagagcaca
acatattacaagaacgcgaataagcttgaaaagtttatgaagagcaagataagagaggta
ccagagtacgccgatatggttgactga

DBGET integrated database retrieval system