KEGG   Komagataella phaffii: PAS_chr4_0018Help
Entry
PAS_chr4_0018     CDS       T01092                                 

Definition
(RefSeq) Cytochrome c, isoform 1
  KO
K08738  cytochrome c
Organism
ppa  Komagataella phaffii
Pathway
ppa00920  Sulfur metabolism
ppa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PAS_chr4_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 8200541
NCBI-ProteinID: XP_002493423
UniProt: C4R6L9
Position
4:42361..42693
Genome map
AA seq 110 aa AA seqDB search
MPAPYEKGSEKKGATLFKTRCLQCHTVEAGGPHKVGPNLHGVFGRKSGLAEGYSYTDANK
RKGVEWSEQTMSDYLENPKKYIPGTKMAFGGLKKAKDRNDLITYLAKATK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacgaaaaaggttcagagaagaaaggtgctactttgttcaagaccaga
tgtctgcaatgtcacactgtcgaggctggtggaccacacaaagttggtcctaacttgcat
ggtgtcttcggaagaaagtctggtttggctgagggatactcttacaccgatgccaacaag
agaaagggagttgaatggtccgagcaaaccatgtccgactacttggagaacccaaagaag
tacattccaggaaccaagatggctttcggtggtctaaagaaggccaaggacagaaacgac
ttgattacctacttggccaaggccaccaaatag

DBGET integrated database retrieval system