KEGG   Komagataella pastoris: PAS_chr4_0018Help
Entry
PAS_chr4_0018     CDS       T01092                                 

Definition
Cytochrome c, isoform 1
Orthology
K08738  
cytochrome c
Organism
ppa  Komagataella pastoris
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PAS_chr4_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:42361..42693
Genome map
AA seq 110 aa AA seqDB search
MPAPYEKGSEKKGATLFKTRCLQCHTVEAGGPHKVGPNLHGVFGRKSGLAEGYSYTDANK
RKGVEWSEQTMSDYLENPKKYIPGTKMAFGGLKKAKDRNDLITYLAKATK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacgaaaaaggttcagagaagaaaggtgctactttgttcaagaccaga
tgtctgcaatgtcacactgtcgaggctggtggaccacacaaagttggtcctaacttgcat
ggtgtcttcggaagaaagtctggtttggctgagggatactcttacaccgatgccaacaag
agaaagggagttgaatggtccgagcaaaccatgtccgactacttggagaacccaaagaag
tacattccaggaaccaagatggctttcggtggtctaaagaaggccaaggacagaaacgac
ttgattacctacttggccaaggccaccaaatag

DBGET integrated database retrieval system