KEGG   Komagataella pastoris: PAS_chr4_0022Help
Entry
PAS_chr4_0022     CDS       T01092                                 

Definition
Ubiquitin-specific protease that may play a role in ubiquitin precursor processing
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
ppa  Komagataella pastoris
Brite
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PAS_chr4_0022
Peptidases [BR:ppa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAS_chr4_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:50272..53898
Genome map
AA seq 1208 aa AA seqDB search
MEESIPTPPLEEMEVSGMDSSASQSPNPVDVIQHDSSNFEAVKEHVLPPVPPDYEVEFEG
YFTWNIQDWRKLSDSKIVSPRFVLGNYKWNLLIFLKRANNGTNIGIYLEPHPLDDDQEQD
PNWYVCAQFAIDLWNPEYPYIHKSNASYHRFNQDVTDWGFSTFLELRNLHRASKSYDKPF
LFDNKLNITVYVRVIKDHTGVLWHSFVNYDSKKETGLVGLNNQGATCYLNSLLQSYYFTN
IFRKKVYAIPTDDEAKNEQISEETISVSLALQRVFYQLQKSNLPVDTTELTRSFGWDTNE
AFIQNDVQEMNRLLMEKLENKMKGTSIEGCLNDIFVGKMKSFIRCIHVDYESSRIEDFWD
IQLNVKNMGSLQNSFENYIELETLSGENKYDASGFGLQDAEKGVVFESFPPVLHLQLKRF
EYDFVYDQLVKINDRHSFPDEIDLKPYLDSAGDAYDEDWVYSLHGVLVHTGDISTGHYYA
MIKPSIENTWYRFDDDKVWKVTRSQVFDENFGFDELQPDVVRSMTRSQFLDYQQKRHTSA
YMLVYIRKSQEKAVLEPVTDADVPSHIPEQIHKELEERDLLEKERREMHLYEHLKIITNQ
TFSKYEGFDLTPNVSDLNYYASDLFDEESYPLDVKLLKTEPLSKLYDLVSDSLGGVDPRH
FRFWHVSTRRNYTARPDGPVPLTYDTSKIPIGEVFKLNSGKKLVQQTFLFVEEVGKELNF
VSKKLLELNKQNPKLDSEINSNNKFEILKQRYSQIPSDTFPPFHSCDQDSILLFLKYFDP
KSQNLQGLTHVVVNKDAKVSTLTKSVNYFMGFDLETPLNFYEEIEPKSIEPIILEISFAE
SELLNGDIICFTRADTESDGSIKENIDGYGSVITYYNFLESRIHLFVRPALLDSYLNEED
EKNLESKTFHVWVPSQIPYDCLVARFAKEIKTDPDYLRLYGVNHDDTRIAIHRNTRLRDI
LPRSVKPSQTITFEYEILDITLAEFESLVPIEVYWFNNSVLHLQKYELLISKQESIFDLL
GKLQYKIGFNDEVREGILAWTSVDHKFGTLVADENIVSLVLRESTNHIFVGSFPHLKKIL
TTTDENQVLELDDVEIIRGDIREVPVFQFRNEIHRKHGAPFIFDVRRNERFKDTKNRFQR
LLGLGDKEFTKTELVIVSNSIDQQIRYVTDESLLLYDELAEHEQLAIDTPPRAVRRPTIQ
ERALFIKD
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtcaattcctacgccaccactggaagaaatggaggtttctggcatggactca
agtgctagtcagtctcctaatccggttgatgtgatccaacatgactccagcaatttcgaa
gcggtcaaggagcatgttcttccgccagtcccacctgactatgaggttgagtttgaaggc
tatttcacctggaatatacaggactggaggaaactgtctgattccaagattgtaagcccc
cgatttgtgctaggaaattacaaatggaacctgctaatatttctcaagagagctaataat
ggcaccaatattggaatctacctggaacctcacccccttgatgacgatcaagagcaggac
ccgaattggtacgtttgcgctcagtttgcaattgatttgtggaaccccgagtacccttat
atacacaaatcgaatgcttcttaccacagattcaaccaagatgtgaccgattggggattt
agcaccttccttgaacttagaaatttacatcgtgctagcaagtcatatgataagccgttt
ttattcgataataagctcaatatcacagtctatgtgagagtaatcaaagaccacaccgga
gttctgtggcatagttttgtgaattatgatagtaagaaggaaactggcttggtgggcttg
aataaccaaggagctacttgttatttgaactcacttctacagtcatactattttacaaat
atcttccgtaaaaaagtttatgctattccaacggatgatgaggcaaagaacgagcaaatc
agtgaagagaccatcagtgtttctctagcgctacaacgagtcttctatcagcttcaaaaa
tcaaaccttccagttgacacaaccgaactaaccaggtcgtttggatgggatactaatgaa
gctttcattcaaaacgatgttcaggaaatgaatcgtcttttaatggaaaaattagagaat
aaaatgaaggggacttccattgaaggatgtttgaatgatattttcgttggcaagatgaaa
agttttattcgatgcattcacgtcgactatgagagtagcaggatagaagatttttgggat
atacagttgaacgtcaagaacatgggttctttacaaaactcttttgagaactacattgaa
ctggagacgttgagcggcgaaaataaatacgacgcctctggttttggccttcaggacgcc
gagaaaggtgttgtatttgaaagcttcccaccagttttgcatttgcaattaaaaagattc
gaatacgactttgtctacgatcagttagttaaaataaacgatcgccactccttccctgat
gaaattgacctcaagccgtatttggatagtgctggtgatgcttatgatgaggattgggtc
tattctttacatggtgtacttgttcacacaggagatatttctacgggccactactacgct
atgattaagccaagtattgaaaacacctggtacagatttgatgatgacaaagtctggaaa
gtaactaggagccaggtgtttgacgaaaattttggctttgacgagcttcagccggatgtg
gttagatcaatgactagatctcagtttttggattaccaacagaaacgtcatacgtctgca
tatatgcttgtctacattaggaagagccaagagaaagcagttctagaaccagtgacagac
gcagacgttccatcgcacattcctgagcagatccacaaagaattagaggagcgtgacctt
ttggaaaaagaaagaagggagatgcacttgtatgagcatctgaagattatcaccaaccag
acattctccaagtatgagggctttgatttgaccccgaatgtttcggacttgaactattat
gctagtgacttgtttgacgaagaatcttacccactagacgttaagctactgaaaaccgaa
cctttgtcgaagttatatgatctggtatcagattctttgggaggagtggatcccagacat
tttagattctggcatgtatccacgcgacgaaattatacagcaagacctgatggtccggtt
ccactgacttatgatacttctaaaataccaattggcgaggtatttaaactgaattctggt
aagaagctagttcaacagacattcttgtttgtggaagaagtcggcaaagagcttaatttt
gtctccaagaaacttctggaactaaataagcaaaacccaaagcttgattctgagatcaat
tccaacaacaagtttgaaattctcaagcaaaggtattctcagatccctagtgatactttt
cctccttttcatagctgcgaccaagattcgattcttttatttctgaagtactttgacccc
aagtcccaaaatttgcaaggtttgactcatgtcgtcgtgaacaaggatgccaaggtgtct
acattgaccaaatctgtcaattattttatgggatttgatttagagactccgttaaacttt
tacgaagaaattgagccgaaatctattgaaccaatcatccttgaaatttcgtttgctgag
tcagagctattgaatggagatatcatttgtttcacgcgggccgacaccgaatctgatgga
tcaatcaaggagaatatagatggttatggatctgttattacctactacaactttttggaa
tctagaattcatctgtttgtgagaccggctctactggattcctacttgaacgaagaggat
gagaaaaatttggagtccaagacattccatgtatgggttccctctcaaattccttatgac
tgtcttgttgccagatttgcaaaagaaatcaaaactgatcccgactatttacgcctgtat
ggagtgaaccatgatgatactagaatcgctatccataggaacacacggttgcgtgacatc
cttcctcgaagcgtcaaaccgtctcaaacaattacctttgagtatgagattttagatatc
actttggcggaatttgaaagtttggtcccaatcgaggtttattggttcaacaattcagtt
ctccacctacaaaagtatgagcttttaatatccaaacaggaatctatatttgatttgctg
ggcaagctacagtacaagatcggcttcaacgatgaagttcgggagggtattcttgcatgg
acttctgttgatcacaagttcggaaccttagtcgctgacgaaaatatagttagtttggtt
ctgcgagagagtaccaaccatatattcgttggctcctttcctcatctcaaaaagatcctc
accacaaccgacgagaaccaagttttggaacttgatgacgttgagatcatcagaggggat
atcagggaggttcctgtgttccaatttaggaatgaaattcatcgtaaacatggcgcgcct
ttcatctttgatgttagaagaaatgagagattcaaagatactaagaatagatttcaacga
ctgttgggattaggagacaaagaatttacgaagacagagcttgtaatagtctctaattcc
atagaccaacagatacgttatgtgacggatgaatcactcttactttatgatgaactggca
gaacatgaacaacttgccattgacacaccaccaagggctgtcagacgtccaactatccaa
gaacgagcgctattcattaaagattag

DBGET integrated database retrieval system