KEGG   Pichia pastoris: PAS_chr4_0034Help
Entry
PAS_chr4_0034     CDS       T01092                                 

Definition
Subunit of heterotrimeric Replication Protein A (RPA)
Orthology
K10739  
replication factor A2
Organism
ppa  Pichia pastoris
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:ppa03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ppa03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ppa03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:70728..71483
Genome map
AA seq 251 aa AA seqDB search
MSYQPYNNFNDNAEGGGFTTYNNNDGDGQGSQGKTQQRNTIKPVTIKQINDSKTIISDGE
FVVNGVELNMVSFVGIIRNVNDNTSSLTITIEDGTGSLDVRKWVDEGSDPSENNYPLGQY
VYVTGLLKEFNEKKSLQQATINPIEDYNQVTYHYLSAIKVHVEANQQGSHQQGNSLFVSQ
NADDHTNSNDPSEKVYRFIHDNTPSMVEGVPIQYIAQSLSLTDNEVINYCNQLSDVGKIY
NGNDDSSYLAV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtaccaaccatacaataactttaatgacaatgcagaaggtggcggattcaccacc
tataacaataatgacggagatggccagggttcacagggaaaaactcaacagagaaataca
attaagccggttacaatcaagcagatcaatgacagcaagactataatctccgatggcgaa
tttgtcgtgaatggagtcgaattgaatatggtttcattcgtaggaattatcaggaatgtc
aacgacaatacctcttctttgactataacgatagaagatggtactggatctctggatgtc
agaaaatgggtggacgaaggctcagatccatccgagaataactaccctttgggacaatat
gtatacgtcacagggttgctcaaagagtttaacgaaaaaaagtcacttcaacaggccact
atcaatccgattgaagattataaccaagttacttaccactacctctcggccatcaaggtt
catgtagaggccaatcaacagggttctcatcagcaaggaaactctttatttgtatctcag
aatgcagacgaccatacaaacagcaatgatccttctgagaaggtctaccgtttcattcac
gataacacgccctctatggttgaaggcgtccctatacagtacattgcacagtcactatca
ttgactgataatgaagtaatcaactactgcaaccagctttcagatgttggtaagatttac
aatggtaatgacgatagcagctatcttgctgtctaa

DBGET integrated database retrieval system