KEGG   Komagataella phaffii: PAS_chr4_0034Help
Entry
PAS_chr4_0034     CDS       T01092                                 

Definition
(RefSeq) Subunit of heterotrimeric Replication Protein A (RPA)
  KO
K10739  
replication factor A2
Organism
ppa  Komagataella phaffii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PAS_chr4_0034
   03420 Nucleotide excision repair
    PAS_chr4_0034
   03430 Mismatch repair
    PAS_chr4_0034
   03440 Homologous recombination
    PAS_chr4_0034
DNA replication proteins [BR:ppa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    PAS_chr4_0034
DNA repair and recombination proteins [BR:ppa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     PAS_chr4_0034
   MMR (mismatch exicision repair)
     PAS_chr4_0034
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     PAS_chr4_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:70728..71483
Genome map
AA seq 251 aa AA seqDB search
MSYQPYNNFNDNAEGGGFTTYNNNDGDGQGSQGKTQQRNTIKPVTIKQINDSKTIISDGE
FVVNGVELNMVSFVGIIRNVNDNTSSLTITIEDGTGSLDVRKWVDEGSDPSENNYPLGQY
VYVTGLLKEFNEKKSLQQATINPIEDYNQVTYHYLSAIKVHVEANQQGSHQQGNSLFVSQ
NADDHTNSNDPSEKVYRFIHDNTPSMVEGVPIQYIAQSLSLTDNEVINYCNQLSDVGKIY
NGNDDSSYLAV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtaccaaccatacaataactttaatgacaatgcagaaggtggcggattcaccacc
tataacaataatgacggagatggccagggttcacagggaaaaactcaacagagaaataca
attaagccggttacaatcaagcagatcaatgacagcaagactataatctccgatggcgaa
tttgtcgtgaatggagtcgaattgaatatggtttcattcgtaggaattatcaggaatgtc
aacgacaatacctcttctttgactataacgatagaagatggtactggatctctggatgtc
agaaaatgggtggacgaaggctcagatccatccgagaataactaccctttgggacaatat
gtatacgtcacagggttgctcaaagagtttaacgaaaaaaagtcacttcaacaggccact
atcaatccgattgaagattataaccaagttacttaccactacctctcggccatcaaggtt
catgtagaggccaatcaacagggttctcatcagcaaggaaactctttatttgtatctcag
aatgcagacgaccatacaaacagcaatgatccttctgagaaggtctaccgtttcattcac
gataacacgccctctatggttgaaggcgtccctatacagtacattgcacagtcactatca
ttgactgataatgaagtaatcaactactgcaaccagctttcagatgttggtaagatttac
aatggtaatgacgatagcagctatcttgctgtctaa

DBGET integrated database retrieval system