KEGG   Komagataella pastoris: PAS_chr4_0055Help
Entry
PAS_chr4_0055     CDS       T01092                                 

Definition
Protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ppa  Komagataella pastoris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAS_chr4_0055
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PAS_chr4_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(114813..116495)
Genome map
AA seq 560 aa AA seqDB search
MLKSLAPNSSIAVLGSGISGLTFSFFLNRLRPDVKIHIFEKSKQVGGWIRSEEHETFHFE
KGPRTLRGTNTGTLMLLDLLTKIGANDKVLGLHKDSLANKKYLLSPFSDVHGNNAKLLQV
PQDFSSFVKFMFDPLSKDLILGLLKEPWQPKLKYSDESVDHFFNRRFATKLSENIVSAIV
HGIYAGDVKKLSVKAIFPRLPEMEQESGSIIRYMIAQYRTKKNVKQKVDPFLADYEKLIG
TSLSFKNISLFLKNFPMLSFQGGLQKLPISLKNHLSQIENIKFHFDSKIKNIALESGKVA
LTDHDQVYLVDHVRSTINTNELAKIISPVVPSSTKKKSVFKSKANGPGLVKCLSWLHYTN
ILMCNIYIPKHVSKSITGFGYLVPRSMSSQASKLLGVIFDSDIETAMTPNFTEANITAIN
SNSASPKQLQKFSDQFVNNDLPKYTKLTLMLGGHYLKSEADMPGSAESKHAVKAILSNHL
NIDLDEFASLPDFKMEITKIPNCIPQYEVGYLDLKRKVQNAASKEFNDQISFGGMAFGDG
VGIPDCVQNAFKDSATLSGI
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaagtcttgcaccaaattcctcaattgccgttttaggttcagggatatctgga
ttgactttcagcttttttttgaatcggttgcgtcccgatgttaagatccatatctttgaa
aaatccaagcaggttggaggatggatcagatcagaagagcatgaaacttttcattttgaa
aagggacccagaactttgagaggcacaaatacgggtaccttgatgttgttggatcttctt
accaagataggagcaaatgacaaggtcctgggactgcacaaagattctcttgctaataaa
aagtatctgttgtccccgttctcagatgttcacggaaacaacgcaaagcttcttcaagtg
ccacaggatttcagctcttttgtaaagttcatgtttgacccgttgtctaaggatctcatt
ctcggtcttttgaaagaaccatggcaaccaaaattaaagtattcagatgagtcggttgac
cattttttcaacagaagatttgctaccaaactatcagagaatatcgtcagcgcaattgtg
catggaatctatgcgggcgacgtgaagaagttaagtgtgaaagccatcttccctaggctc
cctgagatggaacaggaaagtggctctattataaggtatatgatcgcccaatacaggaca
aaaaagaacgtcaaacaaaaagttgacccttttttggcagattatgaaaaattgatcggt
acatctttgagtttcaaaaatatttctttgtttctgaaaaactttcccatgctgagtttt
cagggtggactacagaaacttcccatctcattgaagaaccatttatcacagattgaaaac
atcaagtttcattttgacagcaaaatcaaaaacattgctttggagagcggtaaggtggca
ttgactgaccatgatcaggtttatcttgttgaccatgtgagatctaccattaataccaac
gaattggccaaaatcatttcacccgttgttccaagttctactaagaaaaaatccgttttc
aaatccaaagcgaatggcccagggctggtcaaatgtttgagctggctacactatacaaat
atactaatgtgcaacatttatatacctaagcacgtctcaaaatctatcaccggatttgga
tacttggttcctcgatcaatgtcttctcaggcatccaaacttctcggtgtcatatttgac
tcagacatcgagactgcaatgactcctaattttacagaggccaacattacggcgataaac
agtaactctgcatctcccaagcaactccaaaagttttctgaccaattcgtcaataatgat
ctccctaaatacaccaagttgacgctaatgcttggaggtcattatctcaagtcggaggca
gacatgcccggttccgcagagagtaaacatgctgtcaaggcgattctgtcaaatcacctg
aatattgatctagatgagtttgcatctttgccagacttcaagatggaaatcaccaagatc
cccaactgcattccccaatatgaagttgggtatcttgatctcaagagaaaggttcagaat
gcagcctccaaagagttcaacgaccaaataagttttggaggcatggcatttggtgatggt
gtggggatccctgactgtgtccagaatgcattcaaagattcggctaccctcagtggcatt
taa

DBGET integrated database retrieval system