KEGG   Komagataella pastoris: PAS_chr4_0084Help
Entry
PAS_chr4_0084     CDS       T01092                                 

Definition
Histone acetyltransferase catalytic subunit of the native multisubunit complex (NuA4)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ppa  Komagataella pastoris
Brite
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAS_chr4_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:162650..164044
Genome map
AA seq 464 aa AA seqDB search
MTASPEPIEIQEAKLVVPEQYSEEQFAPGELKVGCTVSAFKDGEVRLAEVLSIQQKKNRL
VFYVHYQDFNKRLDEWIEKDRIDYKRPVFWPKPKSEKKDKTKSNKGKNNKQIKSNKGDST
VKQEDTSVDLSGKDSAGQDVMDLDNLNVQGLVKEGEELTREDEIKKLRTGGSMIQSHNEV
SKVRNFSKVIIGKHIVEPWYFSPYPVELTEEDEIYICDFTLSFFGSRKQFERFRIKNTLR
HPPGNEIYRDDVVSFFEIDGRRQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTIRDD
LGHHLVGYFSKEKESADNYNVACILTLPQYQRHGYGKLLIQFSYELSKTEGKVGSPEKPL
SDLGLLSYRAYWADTIVKLLMENGTETTIDEISAQTSMTTTDILHTLQTLNMLKYYKGQH
IICLTDQVVKQYDRLIKRKRHVLDPAKLSWKPPVFTASQLRFGW
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgtctcctgagccaatagaaattcaggaagcaaagctggtggttcctgaacag
tatagtgaggaacagtttgcgccaggtgagctcaaagttggatgtactgtgagcgcattc
aaagatggggaagtaagactagcagaagttctttccatacagcaaaaaaagaacagacta
gttttctacgttcattaccaagatttcaataagcgtctagatgaatggattgagaaagac
agaattgattacaagagacccgttttttggcccaaaccaaaatctgagaagaaagacaag
acgaaatccaataaagggaagaacaataaacagataaagtctaacaagggcgacagcaca
gtgaaacaagaggacacaagtgttgacctgtcaggaaaggatagcgcaggccaggatgtt
atggatttggataatcttaacgtccaaggattggttaaggagggcgaggagctgaccagg
gaggatgaaatcaaaaaattaagaacagggggatcaatgattcagagtcataatgaagtt
tccaaagtcagaaatttttcgaaagtcataatcggaaaacatattgttgaaccttggtat
ttttctccataccctgtagagcttacagaagaagacgagatttacatctgtgattttacg
ttgagtttctttggatcccgtaaacagttcgagaggttcagaataaaaaacactttgagg
catccaccaggaaatgaaatttacagagatgacgtcgtttcgttttttgagattgatgga
agacgtcaaaggacgtggtgcagaaatctatgtctcctatcgaagttgttcctggatcat
aagacgttatattatgacgtggatccgtttctgttttactgtatgacaatcagagatgac
cttggccaccatttagtagggtacttttccaaagagaaggaaagtgcggacaattacaac
gtggcatgtattttaacacttccccaatatcaaagacatggatacggtaagcttctaatt
caattctcatatgaattaagcaaaacagaaggaaaagtcggatctccagaaaagccatta
tccgatttaggtttgttatcatacagagcttactgggctgatacgattgttaaactactt
atggaaaacgggaccgagactaccatcgatgagatttctgcccagacatcgatgacaacc
acagacattctacatacactgcagacattgaacatgcttaagtattacaaaggccagcat
attatatgtctgacggatcaagttgtcaaacaatacgacagactaatcaaaaggaaacgt
catgttttagatcccgctaaattatcctggaagcctcctgtatttactgcctcacaattg
cgtttcgggtggtag

DBGET integrated database retrieval system