KEGG   Komagataella pastoris: PAS_chr4_0098Help
Entry
PAS_chr4_0098     CDS       T01092                                 

Definition
Subunit of Elongator complex, which is required for modification of wobble nucleosides in tRNA
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ppa  Komagataella pastoris
Brite
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAS_chr4_0098
Transfer RNA biogenesis [BR:ppa03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PAS_chr4_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:194369..196039
Genome map
AA seq 556 aa AA seqDB search
MAVGMQVTKSKQKMAPEKERFLQCCGDISMELVASLKNSKDIHLNGLITRYSKKYKLKQQ
PRLTDIISSIPDQYKKYLIPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPG
GPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRIEQLRQLGHSIDKVEYIIMGGTF
MSLPVDYREGFITQLHNALTGYNGKDIDEAIKFSQQSLTKCVGITIETRPDYCTETHLSD
MLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCETFGYSKDAGYKVVSHMMPDLPNVGM
ERDLEQFKEYFESPAFRTDGLKLYPTLVIRGTGLYELWKTGRYRSYNANALIDLVARIMA
LVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTSCRDVRTREVGIQEVHHK
VQPDQVELIRRDYYANGGWETFLSYEDPKQDILIGLLRLRKCSKKYTFRKEFTSQPTSVV
RELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAARIAKEEHGSEKLSVISGVGVRNYYAR
LGYTLDGPYMSKSLID
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgggaatgcaagtcacaaagtccaaacaaaaaatggctccagaaaaggagcgg
ttcttgcaatgctgtggtgacatttctatggaactggtggcttctcttaagaactcaaaa
gatattcatttgaatggtttgataaccagatactctaaaaaatacaaattgaaacaacaa
ccaagactcacggacattatctcatccattccagatcaatacaagaagtatctaattcct
aaattgaaggccaaacctgttagaactgcctccggtattgctgtcgttgcagtaatgtgc
aaacctcatcgctgtcctcatattgcttacactggtaacatttgtgtttactgtcctggt
ggtccggattctgactttgaatacagtacacaatcatacacaggttacgagccaacatca
atgagggccatcagagctcgttatgatccatacgagcaggctcgtggtagaatcgaacag
ttacgtcagctaggacactcgatagacaaagttgagtatattataatgggaggtactttc
atgtccttacctgtagattacagagagggatttataacccaactacataatgctcttacg
ggctacaatgggaaggatatcgacgaggcaataaagttttcacagcaatcacttaccaaa
tgtgtggggattacaattgaaaccagaccagactactgtacagaaacccatcttagcgac
atgttaaaatacgggtgcacccgtttggagattggtgttcaatctgtttatgaagatgtt
gcacgcgatactaacagaggtcacaccgtcaaagctgtatgtgaaaccttcggttactcc
aaagatgctgggtataaggttgtcagccatatgatgcctgatctgcccaacgtcggcatg
gaaagagatttagaacagttcaaagagtactttgaaagcccagcttttaggacggatggg
cttaagctgtatccaactttggtcattcggggaactggtctctatgaactttggaagact
ggacgttacagatcttacaacgccaatgcccttattgatctagtggctaggattatggca
ttagttcctccttggacccgtatttacagagttcaaagagatattcctatgcctttggtg
acgagtggtgttgagaatggaaatcttcgtgaattggctcttgctcgtatgaaagacttt
ggtacttcatgtcgtgatgtcagaacgagagaagtcggaatacaggaagtgcatcataaa
gtgcagccagatcaagtggaattaataagaagagattactacgccaatggaggttgggaa
actttccttagttacgaggacccaaagcaagatattcttattggtttactgagattaaga
aagtgctctaagaagtacaccttcagaaaagagtttaccagtcaaccaacgtctgttgtc
agagagctgcatgtctatgggtctgtagtcccgctacattcaagagacccaagaaagttc
caacatcagggtttcggcactctgctgatggaagaggcagcacgtattgccaaagaggaa
cacggttctgaaaagctcagtgttattagtggagtcggcgttagaaactactacgctcgt
ctaggttacactttggatggcccatatatgtccaaatcattgatagactaa

DBGET integrated database retrieval system