KEGG   Komagataella pastoris: PAS_chr4_0149Help
Entry
PAS_chr4_0149     CDS       T01092                                 

Definition
Microsomal cytochrome b reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ppa  Komagataella pastoris
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAS_chr4_0149
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PAS_chr4_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:293884..294717
Genome map
AA seq 277 aa AA seqDB search
MDNNVVVFTAILVVVSIAAYILLFSNSDRKVLKKDEFQPFPLIQRTQLTHNTAIFRFGLP
RPTDVLGLPIGQHISIAASIGGKEVLRSYTPTSTDDAKGYFDLLIKVYEQGNITKYVDNL
KLGESIRVRGPKGNFTYTPNMVKELNMIAGGTGITPMYQIITAIARNPEDKTRVNLIYGN
QKEEDILLREELESISVLNPNIKIFQTLDAPPANWEGGVGFVTEEMMRTVLSEANDSNKL
LICGPPPMVSSCKKNAVLLGYPKAKPVTKLADQVFVF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggacaataacgttgttgtattcactgctatattggtagtggtgtccattgctgcctac
attctactgtttagcaattctgatagaaaagttttgaagaaagacgaatttcaacccttc
cctctcattcaaagaacacaactgactcacaacacggccattttcagatttggattgccc
cgtcctactgatgtcttgggtctgcctattggtcaacatatctcaattgctgcttctatt
gggggaaaagaagttttgagatcttatacacccacttctaccgacgatgccaagggatac
ttcgacctgttgatcaaggtctatgaacagggaaatatcaccaagtatgtagacaatctc
aaactaggggagtctattcgtgttagaggtcctaagggaaactttacttacactcctaac
atggttaaagaattgaacatgattgcaggaggaaccggtatcactcccatgtatcaaatc
attacagcaattgctagaaacccggaagacaaaactcgagtcaacttgatttacggtaac
caaaaagaggaagatattcttttgagagaggagctcgagagtattagtgttttgaaccca
aatatcaaaatttttcagactttagacgctcctcctgctaactgggaaggtggggttggt
ttcgtcactgaagaaatgatgagaaccgtgctctctgaggctaatgattctaacaaattg
cttatttgtggacctcctcccatggtgtcgtcatgcaaaaagaacgctgtccttttaggt
tatccaaaggccaagccggttaccaagttggctgatcaagtatttgtcttttag

DBGET integrated database retrieval system