KEGG   Pichia pastoris: PAS_chr4_0153Help
Entry
PAS_chr4_0153     CDS       T01092                                 

Definition
Phospholipase B (lysophospholipase) involved in phospholipid metabolism
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ppa  Pichia pastoris
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PAS_chr4_0153
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PAS_chr4_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(303928..305829)
Genome map
AA seq 633 aa AA seqDB search
MALPIVATLLIALGLEIVSAWSPTGGYAPGEVECPDVSSLIRDGSSLSEREQDWVEARHK
ITDENLKDFLNHANLSDFDVEQFLSSSDHSITIGVAFSGGGYRAMLSGAGQLSALDNRTT
GAWEYGLGGLIESTTYITGLSGGNWMLGTVVFNNWTSIEDILSGGDIWDLENPLYNPGGW
NVLETSIFWDDVSDQLDEKEDAGFENSLTDPWGRALSRQFFPSYPSFGAGLTFSTLQSFP
EFTNQEIPFPIHVAVGRTPGSQIISLNSTVFEFNAFEMGSWDPSVYGFTDLTYLGTNVTN
GVPNNADDERGCIAGFDNTGFVLGTSSSLFNQFILQLNTSDLSGAIYQIIEHFLTGLSED
EDDIAIYSPNPFYKSTYAGVGAIAENDTLYLVDGGEDNQNVPLQPLLQKERDVDIIFAFD
NSADTDLSWPNGSSLVNTYMRQFSSQANGTTFPYVPDTTTFLNLNLSSKPTFFGCDARNL
TDIVEGTDHIPPLVVYLANRPFSYWSNTSTFKLDYSESEKRGMIQNGFEVSSRLNMTIDE
EWRTCVGCAIIRRQQERSNATQTEQCRRCFENYCWNGDIDTSTEDIPVNFTTTGATNEEN
DNSTSISSANSVAPSKLWYQAPLLLVGLVAFFI
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggcccttcctattgtggcaactttactcatagctcttggcttggaaattgtttctgca
tggtctcccactggaggatatgctccaggagaagttgagtgtcccgacgtttcctcattg
atccgagatggttcctcactatccgaaagagaacaagattgggttgaagcccgacacaag
atcacagatgaaaatctaaaagactttttgaaccatgcgaacctctctgactttgacgtt
gagcagttcctgtcatcttccgaccactctatcacgataggtgttgccttttcaggaggt
ggttaccgagccatgttgtccggtgcaggtcaactatctgccctggataacagaactact
ggagcatgggagtatggtctaggtggactcattgagtctaccacttatattacaggactt
tccggtggaaattggatgctaggaactgtggtgttcaacaattggacttccatagaggat
atcctcagtggtggtgatatttgggatcttgagaacccactttacaatccaggtggatgg
aatgtcttggaaacttcaatattctgggacgatgtttccgatcagttggatgaaaaggaa
gatgccggatttgaaaattctttgactgatccttggggtagagctttgtcaagacagttc
ttccctagttacccaagttttggtgctggacttacgttctctacgctacagagtttcccc
gagttcactaatcaagagatcccattccctatccatgttgcagtaggaagaactcctggg
agtcaaattatttctctaaattcgacagttttcgagttcaacgcatttgagatgggctca
tgggatccttcagtgtacgggtttactgatttgacatatcttggtactaacgttaccaat
ggtgttccaaataacgcagatgatgagcgtggttgcattgctggatttgacaacactggt
ttcgtgctgggaacttcatcctcgttgtttaatcagtttattctgcaactgaatacgagt
gatctttcaggagcaatttaccaaatcattgagcattttctgactggacttagcgaagac
gaagacgacattgctatctattcccccaaccctttctacaaaagtacgtatgcaggagta
ggtgccattgcggaaaatgacaccctttacttggttgatggtggagaggataaccaaaac
gtccctctgcagcctctacttcaaaaggagcgtgacgttgatatcatctttgcgtttgac
aacagtgcagacactgacctctcttggccaaacggttcatcattagtcaacacctacatg
agacagttttcttctcaagcaaatggaacaacgttcccttatgtacctgataccaccact
ttcctaaacttgaatctttcgagtaagccaaccttctttggttgtgatgctagaaatttg
acagacattgttgaaggcacggatcacattcctcccctggttgtttatctggccaataga
cctttctcgtattggagtaacacttcaactttcaagttagactactctgaatccgagaag
agaggaatgatccaaaacggttttgaagtgtcgtctcgtttgaacatgactattgatgaa
gaatggcgtacttgtgttggatgtgcaatcattcgtagacagcaggagagatccaatgca
acacaaacagagcaatgtagaagatgttttgagaattattgttggaacggtgatattgac
acttccaccgaagatatccccgttaattttaccactactggagcaaccaatgaggagaat
gacaactccacttcaatatcatcggccaattcggtagcaccttccaaactttggtaccaa
gcaccattgctgttggtcggccttgtcgcattcttcatctag

DBGET integrated database retrieval system