KEGG   Pichia pastoris: PAS_chr4_0191Help
Entry
PAS_chr4_0191     CDS       T01092                                 

Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppa  Pichia pastoris
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAS_chr4_0191
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAS_chr4_0191
   00630 Glyoxylate and dicarboxylate metabolism
    PAS_chr4_0191
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PAS_chr4_0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(391316..393061)
Genome map
AA seq 581 aa AA seqDB search
MTPQQTYINPQSPQIYRFITKMAAPRTYGSLEGVQLYGKVDSTPLYDSPITPADILTKDA
LKFVVLLHRTFNSTRKELLENRQKVQAKLDKGEKLTFLPETKYIRDDPNWKCKAPAPGLT
DRRAEITGPPERKMVVNALNTDVYTYMTDFEDSCSPTWSNIIYGQVNLYDALRDQIDFTL
PATGKSYKVKKEGRNPPTIIVRPRGWHMVESHVTVDGEPISASLFDFGLYFFHNARQLLD
NGVGPYFYLPKMEHWLEAKLWNDVFNVAQDALAIPRGTISATVLIETLPISYQLNEVLYA
LRDHSAGLNCGRWDYMFSTIKRLRNDPKHILPDRGLVTMKVPFMTNYVKQLIKVCHQRGV
HAMGGMAATIPIKNDAERNAKAMQAVHDDKLREVLAGHDGTWIAHPALAPIALEVFNKHM
PTPNQLHKIPVYDREVTEEDLVDTNIDGFKITKDGILINIYIGLNYMEAWLQGSGCVSIN
HLMEDAATAEVSRLQLFSWVKHGVKLTDTGEKITKDLVVKLIDDEVAKLSPSRPNNKFDI
AADCLKKEISGEVEVAEFLTDLLYPDVVTLESSPVDLDSLK
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgacaccccagcaaacgtatataaacccacaatccccccagatttaccgctttatcaca
aaaatggctgccccaagaacttacggctcccttgaaggagtgcaattgtatggaaaagtt
gactcaaccccactgtatgatagtccaattacccctgctgatatcctgaccaaagatgct
ttgaaatttgtcgttctacttcacagaactttcaacagtaccagaaaggagcttcttgag
aatagacagaaggtccaggccaaattggacaaaggtgagaagttgactttcctccccgag
actaagtacatcagggatgatcctaactggaagtgtaaggctccagcaccaggactgaca
gatcgtcgtgccgagatcactggtcctccagagagaaagatggtcgtcaatgccttgaac
acagatgtttatacctacatgactgattttgaggactcctgctctccaacatggtctaat
attatttacggacaagttaatttgtatgatgctctcagagatcaaattgacttcactttg
cctgccactggcaaatcatacaaggtcaagaaggaaggtcgcaacccaccaaccatcatt
gtcagacctcgtggatggcatatggttgagagccatgtcaccgttgacggtgagccaatt
agtgcctctctattcgactttggtctttacttcttccacaatgcccgtcaattgctggac
aatggtgttggtccctacttttatttgccaaagatggagcactggttagaggcaaagttg
tggaatgacgttttcaacgtcgctcaagacgctttggccattcctcgtggtaccatcagt
gctactgtcttgatcgagactttgccaatttcctaccaattgaacgaagttttgtatgcc
ctaagagatcattccgctggtttgaactgtggacgttgggattacatgttctccactatc
aaacgtctacgtaatgaccccaagcacattttgccagaccgtggtcttgtgaccatgaag
gttcctttcatgaccaactatgttaagcagttaattaaggtctgtcatcagcgtggagta
cacgctatgggaggaatggctgccacaattcctattaagaacgatgctgaacgtaatgcc
aaggccatgcaagctgttcatgatgacaaactacgagaagttcttgctggccacgacggt
acctggattgcccatccagctttggcaccaatcgctcttgaagtcttcaacaagcacatg
ccaactcctaaccaattgcacaagattcccgtctacgacagggaagttactgaggaagat
ttggttgataccaacatcgatggtttcaagatcactaaagacggtattctgattaacatt
tatatcggtctgaactatatggaggcttggttgcaaggttctggatgtgtgtctatcaat
cacttgatggaagatgctgccactgctgaagtttctcgactgcaattattctcctgggtc
aagcatggtgtaaaacttactgacactggcgagaagatcacaaaggacctggttgtcaag
ttgatcgacgacgaagttgcaaagctgagccccagcagacccaacaacaagtttgacatt
gctgccgactgtttgaagaaggagattagtggagaagtcgaggttgctgagtttttgacc
gacttactgtacccagacgttgttactcttgagtcttctcctgttgatttggacagtctt
aaatag

DBGET integrated database retrieval system