KEGG   Komagataella pastoris: PAS_chr4_0238Help
Entry
PAS_chr4_0238     CDS       T01092                                 

Definition
Subunit of TFIIH and nucleotide excision repair factor 3 complexes
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ppa  Komagataella pastoris
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PAS_chr4_0238
  Replication and repair
   03420 Nucleotide excision repair
    PAS_chr4_0238
Transcription machinery [BR:ppa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PAS_chr4_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(480926..482569)
Genome map
AA seq 547 aa AA seqDB search
MSDSSNLLKTTVNDYLENLPESVHNKLYQSSITCLAIFRLLPSLAKFYVMSLLFNEHSVS
YIDLTRWIRPDNMTHLVSSSTKSSSSSAVTNFPGAIGKNKMYQNECLKRLKQLNLIKDVR
KQWTNPNTGQLTNVVVLQLNPMFRKNFRNALTGSQMSNDLNNDIEMTDVEEVSEEFLDRY
SLMKWENILHFMVGSEVPELPSIGVLSLLRHSGLMDIGEENEFIATPKRFKGDNMDLKSM
KITQDGFQFLLQDINAQIWQLLLQYLRMSEKLMMNPVDVLNFIFMLGSLELGKQYPVTLL
SDTQVIMLEDLVDYGLIYYPEKNRYFYPTRMATTLTSEKTTFKTASMSMNQVLEGGPEVK
DHGSIVLETNFKLYCYTTSPLQIAILNLFVHLRTRFANMVTGMITRESVREALRNGITAD
QIIKYLETHAHSQMKKLAEEKLLKKLEFDSNATETQQIGSQVKLEVIPPTVVDQIKLWQL
EMDRLQTFAGFLFKDFANAQEFEQLANYADEVGVMLWRDDDKRKFFVTEEGIGQLNDYAN
RLKRHRA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattcttccaacctgttgaagaccactgttaacgactatttggagaaccttcct
gaatctgtgcacaacaaattgtaccaatcttcaatcacatgtttagctattttcagatta
ttgccctcactagctaaattctacgtcatgagtcttctattcaatgagcattctgtttct
tacattgacttgacaagatggatacgtccagataacatgacgcacttggtttcgtcctct
acaaagtcgtcttcgtcgtccgcagtcactaattttccaggagcaatcggaaagaataag
atgtaccaaaacgaatgtctgaaaaggttgaaacagctaaacctgatcaaggatgtcaga
aaacagtggactaatcctaatacagggcagttgacaaacgttgttgtacttcaattgaac
ccaatgtttcgtaagaattttcgtaatgctctcacaggatcccaaatgagtaatgatctc
aataatgatatcgagatgacagatgtggaggaagtttcggaggagttcctggatcggtac
tctttaatgaagtgggaaaatatcttacatttcatggtaggctcagaggtgcctgaattg
ccctcaatcggcgttctctcgttattgaggcatagtgggttgatggatattggcgaagag
aacgagtttatagccacacctaaacgtttcaaaggagataatatggatttgaaatccatg
aaaattacgcaggacgggtttcagtttttgttacaagatatcaatgcccagatatggcaa
cttctgctacagtatcttcggatgagtgaaaaattaatgatgaatccagtcgatgtgttg
aattttatcttcatgctgggttctctggaactaggaaaacagtaccctgttactctcttg
agtgacacccaagtgataatgctggaggatttggttgattatggattaatttattatcca
gagaaaaatagatacttctacccaacccgaatggcaacgacattgacatcagaaaaaaca
acattcaaaactgcatcgatgtcaatgaatcaagtgctggaagggggaccggaggtaaaa
gaccacggatctatagtgctggaaactaatttcaaactatactgttacaccacttctccc
ctacagattgctatcctgaatctgtttgttcatttgagaacaagattcgcaaatatggtt
acgggaatgatcacaagagaatctgtaagagaggctctacgtaatggaataactgctgac
caaataataaagtatttggaaacacatgcccattcacaaatgaagaaactcgcagaagaa
aaattacttaaaaagttagagttcgattcgaacgccacggaaactcaacaaatcgggtcg
caagtcaagttagaggtaattcctccaactgtagtagaccagatcaagctttggcagttg
gaaatggatcgacttcaaacttttgccggttttcttttcaaagattttgccaatgcccaa
gaatttgagcaattggctaactacgctgatgaagttggtgtgatgctgtggcgggacgat
gataaacgtaaattcttcgtcactgaggaaggaattggccaactgaatgattatgctaat
aggctaaaaagacatagagcttga

DBGET integrated database retrieval system