KEGG   Komagataella pastoris: PAS_chr4_0418Help
Entry
PAS_chr4_0418     CDS       T01092                                 

Definition
Delta-aminolevulinate dehydratase, a homo-octameric enzyme
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ppa  Komagataella pastoris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAS_chr4_0418
Enzymes [BR:ppa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PAS_chr4_0418
Exosome [BR:ppa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAS_chr4_0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:822075..823100
Genome map
AA seq 341 aa AA seqDB search
MVHKAEYLDDHPTQISSILSGGYNHPLLREWQHERQLNKNMFIFPLFVTDRPDEEELIPS
LPNIKRFGVNKLIPYVGGLVSKGLRAVILFGVPLKPGVKDEEGTAADDPEGPVIQAIKHL
RKNFPDLYIITDVCLCEYTSHGHCGILYEDGTINRELSVRRIAAVAVKYAQAGANSVAPS
DMTDGRIRDIKEGLLSAGLAHKTFVMSYAAKFSGNLYGPFRDAAGSCPSQGDRKCYQLPS
GGKGLAHRALIRDMNEGTDGIIVKPSTFYLDIVADAYQLCKDYPICCYQVSGEYAMLHAA
AEKNIVDLKSIAFEAHQGFLRAGARLIISYFTPEFLEWLSE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtgcataaggctgaatacttggacgaccacccaactcagatttccagcattctttca
ggaggttacaaccacccattacttcgtgaatggcaacatgaacgtcaactcaacaaaaac
atgttcatctttcccctgtttgtcacagatcgaccagacgaagaagaacttattcctagt
ctacctaatatcaagaggtttggcgttaacaagttgattccttatgtaggaggtttggtt
tccaaaggattgagggcggtgatcctatttggtgttcctctgaagcccggtgtgaaagat
gaagaaggaacggccgctgatgatccagagggacctgttatccaagccatcaaacacttg
agaaagaactttcctgacctgtatatcatcaccgatgtctgtctatgtgagtacaccagc
catggacattgtggaatactatatgaggatggcactatcaacagagagctctcagtccgt
cgtattgctgctgtagctgtcaaatatgctcaagctggagccaactctgtggctccttct
gatatgactgacggcagaataagagatattaaagaaggcttactaagtgcaggactggca
cataaaacgtttgttatgtcctacgctgcaaaattctctggtaatttgtatggccctttc
agagatgctgcaggttcctgtccatctcaaggggacagaaaatgttaccagcttccttct
ggaggaaaagggttggcccatcgtgctctgattcgtgatatgaatgaaggcactgatgga
attattgtcaaaccatctacattctatttggacattgtcgctgatgcttatcagctttgt
aaagactatcctatctgctgttaccaggtttctggagagtacgccatgctacatgcagcg
gcagagaagaatattgttgatctgaaatcaatcgcttttgaagctcatcaaggattcttg
cgggctggagctcgtttaatcattagttactttacccctgaattcctggagtggttatct
gaatga

DBGET integrated database retrieval system