KEGG   Pichia pastoris: PAS_chr4_0418Help
Entry
PAS_chr4_0418     CDS       T01092                                 

Definition
Delta-aminolevulinate dehydratase, a homo-octameric enzyme
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ppa  Pichia pastoris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:822075..823100
Genome map
AA seq 341 aa AA seqDB search
MVHKAEYLDDHPTQISSILSGGYNHPLLREWQHERQLNKNMFIFPLFVTDRPDEEELIPS
LPNIKRFGVNKLIPYVGGLVSKGLRAVILFGVPLKPGVKDEEGTAADDPEGPVIQAIKHL
RKNFPDLYIITDVCLCEYTSHGHCGILYEDGTINRELSVRRIAAVAVKYAQAGANSVAPS
DMTDGRIRDIKEGLLSAGLAHKTFVMSYAAKFSGNLYGPFRDAAGSCPSQGDRKCYQLPS
GGKGLAHRALIRDMNEGTDGIIVKPSTFYLDIVADAYQLCKDYPICCYQVSGEYAMLHAA
AEKNIVDLKSIAFEAHQGFLRAGARLIISYFTPEFLEWLSE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtgcataaggctgaatacttggacgaccacccaactcagatttccagcattctttca
ggaggttacaaccacccattacttcgtgaatggcaacatgaacgtcaactcaacaaaaac
atgttcatctttcccctgtttgtcacagatcgaccagacgaagaagaacttattcctagt
ctacctaatatcaagaggtttggcgttaacaagttgattccttatgtaggaggtttggtt
tccaaaggattgagggcggtgatcctatttggtgttcctctgaagcccggtgtgaaagat
gaagaaggaacggccgctgatgatccagagggacctgttatccaagccatcaaacacttg
agaaagaactttcctgacctgtatatcatcaccgatgtctgtctatgtgagtacaccagc
catggacattgtggaatactatatgaggatggcactatcaacagagagctctcagtccgt
cgtattgctgctgtagctgtcaaatatgctcaagctggagccaactctgtggctccttct
gatatgactgacggcagaataagagatattaaagaaggcttactaagtgcaggactggca
cataaaacgtttgttatgtcctacgctgcaaaattctctggtaatttgtatggccctttc
agagatgctgcaggttcctgtccatctcaaggggacagaaaatgttaccagcttccttct
ggaggaaaagggttggcccatcgtgctctgattcgtgatatgaatgaaggcactgatgga
attattgtcaaaccatctacattctatttggacattgtcgctgatgcttatcagctttgt
aaagactatcctatctgctgttaccaggtttctggagagtacgccatgctacatgcagcg
gcagagaagaatattgttgatctgaaatcaatcgcttttgaagctcatcaaggattcttg
cgggctggagctcgtttaatcattagttactttacccctgaattcctggagtggttatct
gaatga

DBGET integrated database retrieval system