KEGG   Pichia pastoris: PAS_chr4_0579Help
Entry
PAS_chr4_0579     CDS       T01092                                 

Definition
Intracellular sporulation-specific glucoamylase involved in glycogen degradation
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ppa  Pichia pastoris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1131823..1133535
Genome map
AA seq 570 aa AA seqDB search
MKLLDGLTISLCISMATSLVLPGFDQLRLQQQNVLSLLPKEKIQIQTLSEIWSYVDCAIA
SLGPKEIVIDSDLSILKPVQASSIPRSEFNQWLLYQRNVSFHGVLNNIGGYGYNADNVSV
GCIIASPSKSSPNYFYQWVRDSAITINTVIEYLYDDNIDDSIDKSELLEAIDGYINNIHH
LQRQDNRSGKFKDGYASLGEPKFMVNGDPFNDSWGRPQRDGPGLRALSVANYIDLLDKLG
IQKDSERLSFIYNEVLKPDLTYVTLYWDHDGFDLWEETNGLHFFTSLTQLKALRRGIELA
LRFEDYEFHRDLKNAYAQLRNFIVGRDSGFQDPRFPHIIEHPNLVDAPAHIRRNGLDIAT
IIAALRSHDVDDAGDIVNIPFGVDNARVLNSLTYLVNDMKFRYPLNQGRIVPGLTLGMAL
GRYPEDTYNGVGTSEGNPWFISTSSAGELIYKLLYLQYKYQQDFVIDSSNREFYEMFLDL
PKDSARGIQIRIPFGSDTYRALSVSLIQYADSFLDVIREHVDNEGQMSEQFNRYNGYMQG
AEKLTWSFGSVWSCLRWRNRILNLLATINE
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaagctattagacggcttgacaatatctttgtgcataagcatggccacctcgctggtg
ttgcctggctttgaccaacttagattacagcagcaaaatgtattatcgttactcccaaag
gaaaaaatccagatccaaacactctcagagatctggtcttatgtggattgcgctattgcc
tccttgggaccaaaggagatcgttatcgactcagacttgtcgattttgaagcctgtccag
gcttcttctatccctagatcagaatttaatcaatggttgctctaccaacgaaatgtctca
tttcatggtgtgctcaacaacatcggaggatacggctataacgcagacaacgtttctgtg
ggatgcattatcgcctctccttcgaagtcttctccaaactacttctatcagtgggttcgt
gatagtgcaatcactatcaacacagtgatagagtatttgtatgacgacaacatagacgat
tctatagacaaaagtgagcttttagaagccatagacggctacatcaacaacattcatcac
ttacaacgtcaggacaatagatctggtaagttcaaagatggctacgccagtctgggagag
ccaaagtttatggtcaacggtgaccccttcaatgactcttggggacgtccccagagggat
ggaccaggacttcgtgcactatccgtggccaactatattgatctgctggataagctggga
attcagaaagattcagaaagactctcattcatctacaatgaagtattgaagccagatctc
acttatgtcaccctctattgggaccacgatggatttgacctgtgggaagagactaatgga
ttgcattttttcactagtttgactcaactgaaggctcttagaagaggtattgaactggct
ctcaggtttgaggactacgaattccatcgtgacctgaagaatgcttatgcccaactaaga
aactttattgttggtagagactctggattccaagatcctcgtttccctcatatcattgag
caccctaatttggtagacgctccagcccatattagaagaaatggtttagatatcgcaacc
atcattgctgcgctgagatctcacgatgttgatgatgcaggcgatatagtcaacatcccg
tttggcgtggacaatgcaagggtcctcaattccctgacctatttggttaatgacatgaag
ttccggtatccactcaaccagggtcgtatcgtccctggtttaactctaggaatggcctta
ggaagatatcctgaagacacctacaacggtgttggtaccagtgaaggaaatccatggttc
atttcaacttccagtgcaggtgaactcatctacaagctgttgtatttgcaatacaaatat
caacaagacttcgtgatagattcttccaatagggaattctacgaaatgtttttggatctg
cccaaagactctgctcgtggaattcaaattcgcatacctttcggaagcgacacctatcgt
gcactgtccgtttctttgatccaatatgcggattccttcttggacgtgatcagggaacat
gtggataacgaaggtcaaatgagtgaacaatttaacaggtacaatggttatatgcaagga
gccgagaaattaacttggagttttggttctgtttggagttgtctccgttggaggaacaga
atactaaacttacttgcaacaattaatgaatag

DBGET integrated database retrieval system