KEGG   Pichia pastoris: PAS_chr4_0684Help
Entry
PAS_chr4_0684     CDS       T01092                                 

Definition
Arginase, responsible for arginine degradation
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ppa  Pichia pastoris
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppa00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1317412..1318392)
Genome map
AA seq 326 aa AA seqDB search
MKTQIDYKFYPTKEVTIISAPFSAGQGKGGVEKGPGLLLKHGLREDLEALGWSVSIKEPL
KGTGLDVPPSELEEEFDRSHGIAKRPTVVAQATERVYRAVKEVSHQKRLPLTIGGDHSIG
VSTLAGFLDANPDACVLWIDAHADINTPETSPSGNIHGFPVALAMGLSREVWPKQFSWLD
EAKNKLAADRIAYIGLRDLDPCEKKRVRELGIAAYSMYHVDKYGIAKVVEMALARINPTG
KSPVHISYDVDALDPLFTPATGTPVRGGLTFREGMYIVEAVAETGNLGALDIVECNPDLA
STDVHEIDTITAGCAIAKSAFGETLV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacagattgattataaattttatcccacaaaggaagttaccatcatcagcgcc
ccttttagcgctggtcaaggtaaaggcggtgttgagaaaggtcctggattactactgaaa
catggacttcgggaagatttggaagctttaggctggtcggtttccattaaggaacctctc
aagggtaccggtctagatgtacccccatcagagttggaggaggagtttgacagatcgcac
ggaattgcaaagagaccaacggtggtagcccaagcgacagagagagtctaccgtgcagtt
aaagaagtttcccatcagaagcgattgcctctgaccataggaggtgatcactcaatagga
gtatccacgttagcaggttttcttgatgctaatccggatgcttgcgtcttatggatcgat
gctcatgctgacatcaatactcctgaaacgtcaccttcgggaaacattcatggcttccca
gttgccttagctatggggctcagtagagaagtgtggcccaaacagttttcgtggttggat
gaagccaaaaacaagctagctgccgacagaattgcttacattggtctgagagatttggat
ccctgtgagaagaaacgtgtaagagaactgggcatcgcagcttactctatgtaccatgtc
gacaagtacggaattgcgaaagtggttgaaatggcattggctagaatcaaccccacagga
aaatcaccagtgcatatttcttacgatgtggatgctcttgatccattattcactcctgcc
accggtacccctgtaagaggagggctgactttccgtgaagggatgtacattgtcgaagct
gttgcagagactggaaacctgggagcgttagatatcgtagaatgcaaccctgacttggca
tcaactgacgttcacgaaattgataccatcacggctggttgtgccatcgctaagagtgcg
tttggagaaaccttagtttaa

DBGET integrated database retrieval system