KEGG   Komagataella phaffii: PAS_chr4_0684Help
Entry
PAS_chr4_0684     CDS       T01092                                 

Definition
(RefSeq) Arginase, responsible for arginine degradation
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ppa  Komagataella phaffii
Pathway
ppa00220  Arginine biosynthesis
ppa00330  Arginine and proline metabolism
ppa01100  Metabolic pathways
ppa01110  Biosynthesis of secondary metabolites
ppa01130  Biosynthesis of antibiotics
ppa01230  Biosynthesis of amino acids
Module
ppa_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    PAS_chr4_0684
   00330 Arginine and proline metabolism
    PAS_chr4_0684
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PAS_chr4_0684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 8201391
NCBI-ProteinID: XP_002494123
UniProt: C4R8L9
Position
4:complement(1317412..1318392)
Genome map
AA seq 326 aa AA seqDB search
MKTQIDYKFYPTKEVTIISAPFSAGQGKGGVEKGPGLLLKHGLREDLEALGWSVSIKEPL
KGTGLDVPPSELEEEFDRSHGIAKRPTVVAQATERVYRAVKEVSHQKRLPLTIGGDHSIG
VSTLAGFLDANPDACVLWIDAHADINTPETSPSGNIHGFPVALAMGLSREVWPKQFSWLD
EAKNKLAADRIAYIGLRDLDPCEKKRVRELGIAAYSMYHVDKYGIAKVVEMALARINPTG
KSPVHISYDVDALDPLFTPATGTPVRGGLTFREGMYIVEAVAETGNLGALDIVECNPDLA
STDVHEIDTITAGCAIAKSAFGETLV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacagattgattataaattttatcccacaaaggaagttaccatcatcagcgcc
ccttttagcgctggtcaaggtaaaggcggtgttgagaaaggtcctggattactactgaaa
catggacttcgggaagatttggaagctttaggctggtcggtttccattaaggaacctctc
aagggtaccggtctagatgtacccccatcagagttggaggaggagtttgacagatcgcac
ggaattgcaaagagaccaacggtggtagcccaagcgacagagagagtctaccgtgcagtt
aaagaagtttcccatcagaagcgattgcctctgaccataggaggtgatcactcaatagga
gtatccacgttagcaggttttcttgatgctaatccggatgcttgcgtcttatggatcgat
gctcatgctgacatcaatactcctgaaacgtcaccttcgggaaacattcatggcttccca
gttgccttagctatggggctcagtagagaagtgtggcccaaacagttttcgtggttggat
gaagccaaaaacaagctagctgccgacagaattgcttacattggtctgagagatttggat
ccctgtgagaagaaacgtgtaagagaactgggcatcgcagcttactctatgtaccatgtc
gacaagtacggaattgcgaaagtggttgaaatggcattggctagaatcaaccccacagga
aaatcaccagtgcatatttcttacgatgtggatgctcttgatccattattcactcctgcc
accggtacccctgtaagaggagggctgactttccgtgaagggatgtacattgtcgaagct
gttgcagagactggaaacctgggagcgttagatatcgtagaatgcaaccctgacttggca
tcaactgacgttcacgaaattgataccatcacggctggttgtgccatcgctaagagtgcg
tttggagaaaccttagtttaa

DBGET integrated database retrieval system