KEGG   Komagataella pastoris: PAS_chr4_0700Help
Entry
PAS_chr4_0700     CDS       T01092                                 

Definition
Phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ppa  Komagataella pastoris
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PAS_chr4_0700
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    PAS_chr4_0700
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     PAS_chr4_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1344600..1347188
Genome map
AA seq 862 aa AA seqDB search
MDLSSRLSSLRNIDSSSDTLPSYSNPNDRNIIKSLLVKGKSLIGKEKHRTFDLPQSNKEH
FPSHPIDKKTIPPEFISPGVPLVRVTHKKKVNKSFRIDFDNGLLVWDSKASSSIKISKIK
QIRQQHQAWNYIEELQVPRSLTKFWISIIYIPAKKHKHNNIKTLHLIAGSEESYSLVVET
LTNMVAFNDTLRKTQDLMMVADYCWNNISSNGVVTLEGISGLINHYDMCTESDYIKSLFD
TVNPTDCALTFDQFKTFISLLQERKEVTQLFYYLTSHESNQNQNNITLPTFTIFLRDIQE
ETMSDKEILTCFTSLAIANAQIPLSEFTKFFLSDYLQPIKNIQSEEDLTRPLNEYFISSS
HNTYLLGRQIVGISSVEGYVKALQKGCRCIEIDIWDGSITTNLEEISPPLHDETNDSMRP
VVKHGRSFTSAVDLKQVLKTIKKNAFIRSSLPLILSLEIHCNLENQLTVKRLILETFGTA
LVKEPIMGNESFLPSPLELMHRVLIKVKKTKTVSKSGAANNTSTSLSSSFGTSVSGLSED
ETKNSSKLPIKKISKEKIHPELSFLGIYLSGIKFRNFSLPESKSFNHVFSFSESKLKRFM
KEETKIIALLKHNKRYLMRAYPARFRYSSTNFNPLPFWEIGVPMVATNWQTFDLGQQLNE
ALFDQPFNSPLQGYVLKPSNLRNITITSNKKVDLLKNQAYCKLINVNVQVITARQLSLSN
FKKQPINPFVEFEIHGCNLSCKDQGKILRTKTVQNNGFNPSWDENFNVSFKTNQNNLNFI
RLLVKNDTGSSTYDGNDDNENNNNNNNDSNDNSELISSWCARLAYVKNGYRYLRLVDAQG
EESLCATLFVKFDITEERIITD
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtcttcaaggctgtcctccctcagaaacattgactcaagttctgacacactc
cccagttacagcaaccccaatgaccgaaacatcatcaagtccctgctggtcaaaggaaag
agtttgatcggtaaagagaaacacagaacttttgacctgccccaatccaacaaagaacac
tttccttcacatccgattgacaagaagaccatacccccagaatttatatctccgggagtt
cccctagtcagagtgacacacaagaaaaaagttaataaatcattcagaatagattttgat
aatggactacttgtttgggatagcaaagcttcttcgtccataaagatcagcaagattaaa
cagataagacaacagcaccaagcttggaactatattgaagagctacaagttcctcgatca
ttaactaaattctggatttcaatcatttacattcctgcaaagaaacacaagcataataat
atcaagacacttcatttgattgccggctcagaagaatcgtattcactggtggttgaaact
ctgacgaatatggtagcttttaacgacacattgaggaaaactcaggacctcatgatggtg
gcagactactgttggaataacattagctccaatggagtggtcacacttgagggaatctcg
ggattgatcaatcattatgacatgtgtacagagtcagactatatcaaatctttgttcgat
accgtcaaccccaccgattgtgctttgacctttgaccaattcaaaactttcattagcctg
ctccaagagagaaaagaggtcacccaactattttattatctgacctctcacgagagcaac
caaaatcaaaataatattactttaccaacattcacgatctttttgagggatatacaggag
gaaacaatgtccgataaagagattttaacttgcttcacctctcttgcaattgcaaacgct
caaatacctttgagcgagttcacaaagttttttctttctgactacttacaacccatcaag
aacattcaaagtgaagaagacctcacacgtcctcttaatgaatatttcatatcctcatct
cacaatacctatttgctgggaagacaaattgtaggtatatcttctgtggaaggctatgtg
aaagccctacaaaaaggctgcaggtgcattgaaattgacatatgggatgggagtattacc
accaatttggaggagatttctcctcctttgcatgatgagacgaacgattctatgagacca
gtggtgaaacatggtagatccttcacaagtgccgttgatctcaaacaggtattgaaaacc
atcaaaaaaaatgcatttattagatcatctttacctttaatcctctccttggaaattcat
tgcaacctagagaaccaattgacagtaaagaggctaattttagaaacttttgggactgca
ttagtaaaggaacctatcatgggaaacgaatcatttttaccgagcccgctagagctcatg
catcgggttttaattaaagtgaaaaagactaaaacagtgagcaagtccggagctgcaaac
aataccagtaccagtttaagtagtagttttggaacaagcgtatccggattgagtgaagat
gaaacaaagaattctagcaagctccctattaagaagatttccaaagaaaagattcaccct
gagttaagttttcttggaatttatttgtcgggaataaagttcagaaacttttctttacct
gaatccaaatcattcaaccacgttttttcctttagtgagtccaaactgaaaaggtttatg
aaggaagaaaccaaaataattgcccttttgaaacataataaacgatatctaatgagagca
tatcctgctagattccgttattcgtcaaccaacttcaatccgttgccattttgggagata
ggagtaccaatggttgctacaaactggcagacgtttgatttagggcagcaactcaacgag
gctttatttgatcaaccatttaacagccccttgcaggggtatgtgctgaagccctcaaac
ctcagaaatatcaccattacatctaacaagaaggttgatttgctgaaaaatcaagcctat
tgcaagttgatcaatgttaatgttcaagttattacggccagacaactttctcttagcaat
ttcaagaagcaaccaatcaacccgttcgttgaatttgaaattcatggatgtaatctgtct
tgcaaagatcaaggcaaaatcttgagaacaaaaacggttcaaaacaatggtttcaatccc
tcttgggacgagaacttcaacgtgtccttcaaaacaaatcagaacaatttgaatttcatt
aggctcttagtgaaaaatgacaccggtagttcaacttatgatggcaatgacgataacgaa
aataataacaacaacaacaacgatagtaacgacaattcggagttaatatcttcctggtgt
gcaagattggcttatgtgaaaaatggctacagatatctacgtttagtggatgcgcaaggc
gaagagagtctgtgtgctactttatttgtcaaatttgatattactgaagagagaataatt
accgattaa

DBGET integrated database retrieval system