KEGG   Pichia pastoris: PAS_chr4_0700Help
Entry
PAS_chr4_0700     CDS       T01092                                 

Definition
Phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ppa  Pichia pastoris
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ppa00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ppa04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1344600..1347188
Genome map
AA seq 862 aa AA seqDB search
MDLSSRLSSLRNIDSSSDTLPSYSNPNDRNIIKSLLVKGKSLIGKEKHRTFDLPQSNKEH
FPSHPIDKKTIPPEFISPGVPLVRVTHKKKVNKSFRIDFDNGLLVWDSKASSSIKISKIK
QIRQQHQAWNYIEELQVPRSLTKFWISIIYIPAKKHKHNNIKTLHLIAGSEESYSLVVET
LTNMVAFNDTLRKTQDLMMVADYCWNNISSNGVVTLEGISGLINHYDMCTESDYIKSLFD
TVNPTDCALTFDQFKTFISLLQERKEVTQLFYYLTSHESNQNQNNITLPTFTIFLRDIQE
ETMSDKEILTCFTSLAIANAQIPLSEFTKFFLSDYLQPIKNIQSEEDLTRPLNEYFISSS
HNTYLLGRQIVGISSVEGYVKALQKGCRCIEIDIWDGSITTNLEEISPPLHDETNDSMRP
VVKHGRSFTSAVDLKQVLKTIKKNAFIRSSLPLILSLEIHCNLENQLTVKRLILETFGTA
LVKEPIMGNESFLPSPLELMHRVLIKVKKTKTVSKSGAANNTSTSLSSSFGTSVSGLSED
ETKNSSKLPIKKISKEKIHPELSFLGIYLSGIKFRNFSLPESKSFNHVFSFSESKLKRFM
KEETKIIALLKHNKRYLMRAYPARFRYSSTNFNPLPFWEIGVPMVATNWQTFDLGQQLNE
ALFDQPFNSPLQGYVLKPSNLRNITITSNKKVDLLKNQAYCKLINVNVQVITARQLSLSN
FKKQPINPFVEFEIHGCNLSCKDQGKILRTKTVQNNGFNPSWDENFNVSFKTNQNNLNFI
RLLVKNDTGSSTYDGNDDNENNNNNNNDSNDNSELISSWCARLAYVKNGYRYLRLVDAQG
EESLCATLFVKFDITEERIITD
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtcttcaaggctgtcctccctcagaaacattgactcaagttctgacacactc
cccagttacagcaaccccaatgaccgaaacatcatcaagtccctgctggtcaaaggaaag
agtttgatcggtaaagagaaacacagaacttttgacctgccccaatccaacaaagaacac
tttccttcacatccgattgacaagaagaccatacccccagaatttatatctccgggagtt
cccctagtcagagtgacacacaagaaaaaagttaataaatcattcagaatagattttgat
aatggactacttgtttgggatagcaaagcttcttcgtccataaagatcagcaagattaaa
cagataagacaacagcaccaagcttggaactatattgaagagctacaagttcctcgatca
ttaactaaattctggatttcaatcatttacattcctgcaaagaaacacaagcataataat
atcaagacacttcatttgattgccggctcagaagaatcgtattcactggtggttgaaact
ctgacgaatatggtagcttttaacgacacattgaggaaaactcaggacctcatgatggtg
gcagactactgttggaataacattagctccaatggagtggtcacacttgagggaatctcg
ggattgatcaatcattatgacatgtgtacagagtcagactatatcaaatctttgttcgat
accgtcaaccccaccgattgtgctttgacctttgaccaattcaaaactttcattagcctg
ctccaagagagaaaagaggtcacccaactattttattatctgacctctcacgagagcaac
caaaatcaaaataatattactttaccaacattcacgatctttttgagggatatacaggag
gaaacaatgtccgataaagagattttaacttgcttcacctctcttgcaattgcaaacgct
caaatacctttgagcgagttcacaaagttttttctttctgactacttacaacccatcaag
aacattcaaagtgaagaagacctcacacgtcctcttaatgaatatttcatatcctcatct
cacaatacctatttgctgggaagacaaattgtaggtatatcttctgtggaaggctatgtg
aaagccctacaaaaaggctgcaggtgcattgaaattgacatatgggatgggagtattacc
accaatttggaggagatttctcctcctttgcatgatgagacgaacgattctatgagacca
gtggtgaaacatggtagatccttcacaagtgccgttgatctcaaacaggtattgaaaacc
atcaaaaaaaatgcatttattagatcatctttacctttaatcctctccttggaaattcat
tgcaacctagagaaccaattgacagtaaagaggctaattttagaaacttttgggactgca
ttagtaaaggaacctatcatgggaaacgaatcatttttaccgagcccgctagagctcatg
catcgggttttaattaaagtgaaaaagactaaaacagtgagcaagtccggagctgcaaac
aataccagtaccagtttaagtagtagttttggaacaagcgtatccggattgagtgaagat
gaaacaaagaattctagcaagctccctattaagaagatttccaaagaaaagattcaccct
gagttaagttttcttggaatttatttgtcgggaataaagttcagaaacttttctttacct
gaatccaaatcattcaaccacgttttttcctttagtgagtccaaactgaaaaggtttatg
aaggaagaaaccaaaataattgcccttttgaaacataataaacgatatctaatgagagca
tatcctgctagattccgttattcgtcaaccaacttcaatccgttgccattttgggagata
ggagtaccaatggttgctacaaactggcagacgtttgatttagggcagcaactcaacgag
gctttatttgatcaaccatttaacagccccttgcaggggtatgtgctgaagccctcaaac
ctcagaaatatcaccattacatctaacaagaaggttgatttgctgaaaaatcaagcctat
tgcaagttgatcaatgttaatgttcaagttattacggccagacaactttctcttagcaat
ttcaagaagcaaccaatcaacccgttcgttgaatttgaaattcatggatgtaatctgtct
tgcaaagatcaaggcaaaatcttgagaacaaaaacggttcaaaacaatggtttcaatccc
tcttgggacgagaacttcaacgtgtccttcaaaacaaatcagaacaatttgaatttcatt
aggctcttagtgaaaaatgacaccggtagttcaacttatgatggcaatgacgataacgaa
aataataacaacaacaacaacgatagtaacgacaattcggagttaatatcttcctggtgt
gcaagattggcttatgtgaaaaatggctacagatatctacgtttagtggatgcgcaaggc
gaagagagtctgtgtgctactttatttgtcaaatttgatattactgaagagagaataatt
accgattaa

DBGET integrated database retrieval system