KEGG   Pichia pastoris: PAS_chr4_0710Help
Entry
PAS_chr4_0710     CDS       T01092                                 

Definition
Component of the nuclear pore complex
Orthology
K14298  
mRNA export factor
Organism
ppa  Pichia pastoris
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PAS_chr4_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1360783..1361850
Genome map
AA seq 355 aa AA seqDB search
MSFLSSSNVNVTQGTVQDLQNDVVVGNGPEDSISDLAFSPQAELLAVASWDKKVRVYEVL
PTGTTEGRALYDHESPVLAVHWSPDGTKVATGAADRQVRLYDVQTGQVQNLGMHEAPVKA
LRFVEVGPTSTPVVVSGGWDKTLRYWDPRSAQPMATVALPERVYAMDTSQKLLVVATAER
HIGVIDLNQPQQLFKQTMSPLKWQTRTVACYPQGNGYAIGSIEGRCCLQYIDATEQAKSG
FSFKCHRVPRPAPAKESDVYSINSIRFHPVYGTFSTAGSDGAFHFWDKDQKHRLKGFPAG
PTSISSTAFNRNGGIFAYAYSYDWSKGPEGNSANTPIQLRLHATKDEEVKQRNKK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttcttagttccagcaacgtcaacgtaacgcagggaacagtccaggaccttcaa
aatgacgtggtggtaggaaatggaccagaagattccatcagtgatttggccttctcacca
caggctgaactgctggcggtagcttcgtgggacaagaaagttagggtttatgaagttctt
ccaactggtacgacggaaggaagagctctgtacgaccacgagtcccctgttctagctgtg
cattggtctcccgacggcactaaagtggccactggagccgccgatcgtcaagtacgctta
tatgatgttcaaactggtcaggttcaaaacttgggaatgcacgaggctccggtcaaagca
cttagatttgtggaagtgggccctacttctacacctgtggtagtatcaggaggctgggat
aagactttgaggtattgggaccccaggtcagcacaaccgatggccacagtggcactccct
gaacgagtatacgccatggacacttcacagaaattattggtagtagcaacagcagagcgc
cacataggagtcattgatctaaatcaaccacaacagctgttcaagcaaaccatgtctcct
ttgaaatggcaaacccgtacagtggcatgctatcctcaaggcaatggttatgcaattgga
tcgattgaaggaagatgctgtctacaatatattgatgcaacagaacaggcaaaatctggc
ttttcatttaaatgccaccgagtaccacgacccgctcctgccaaggagtcagacgtttac
tccataaactccattcgatttcaccctgtctatggaacattttctacagcaggtagtgac
ggagcattccatttttgggacaaagatcaaaagcatcgactgaaagggttccctgccgga
cctactagcatttcgtctacagcattcaacagaaatggtggaatttttgcctacgcttat
tcatacgattggagtaaaggccctgaaggaaattcagcaaatactccaatccaattacgt
ttacatgctactaaagatgaagaggtcaaacagcgaaacaagaagtaa

DBGET integrated database retrieval system